PageRenderTime 55ms CodeModel.GetById 36ms app.highlight 10ms RepoModel.GetById 1ms app.codeStats 1ms

/test-data/blastx_sample.xml

https://bitbucket.org/cistrome/cistrome-harvard/
XML | 672 lines | 672 code | 0 blank | 0 comment | 0 complexity | 41a103cdb1e0f6e59e506aeeaae1ed12 MD5 | raw file

Large files files are truncated, but you can click here to view the full file

  1<?xml version="1.0"?>
  2<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "NCBI_BlastOutput.dtd">
  3<BlastOutput>
  4  <BlastOutput_program>blastx</BlastOutput_program>
  5  <BlastOutput_version>BLASTX 2.2.24+</BlastOutput_version>
  6  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  7  <BlastOutput_db>/share/BlastDB/nr</BlastOutput_db>
  8  <BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
  9  <BlastOutput_query-def>phage_suis</BlastOutput_query-def>
 10  <BlastOutput_query-len>1890</BlastOutput_query-len>
 11  <BlastOutput_param>
 12    <Parameters>
 13      <Parameters_matrix>BLOSUM62</Parameters_matrix>
 14      <Parameters_expect>0.001</Parameters_expect>
 15      <Parameters_gap-open>11</Parameters_gap-open>
 16      <Parameters_gap-extend>1</Parameters_gap-extend>
 17      <Parameters_filter>L;</Parameters_filter>
 18    </Parameters>
 19  </BlastOutput_param>
 20  <BlastOutput_iterations>
 21    <Iteration>
 22      <Iteration_iter-num>1</Iteration_iter-num>
 23      <Iteration_query-ID>Query_1</Iteration_query-ID>
 24      <Iteration_query-def>phage_suis</Iteration_query-def>
 25      <Iteration_query-len>1890</Iteration_query-len>
 26      <Iteration_hits>
 27        <Hit>
 28          <Hit_num>1</Hit_num>
 29          <Hit_id>gi|119953746|ref|YP_950551.1|</Hit_id>
 30          <Hit_def>tail tape measure protein [Streptococcus phage SMP] &gt;gi|118430558|gb|ABK91882.1| tail tape measure protein [Streptococcus phage SMP]</Hit_def>
 31          <Hit_accession>YP_950551</Hit_accession>
 32          <Hit_len>659</Hit_len>
 33          <Hit_hsps>
 34            <Hsp>
 35              <Hsp_num>1</Hsp_num>
 36              <Hsp_bit-score>988.407949172964</Hsp_bit-score>
 37              <Hsp_score>2554</Hsp_score>
 38              <Hsp_evalue>0</Hsp_evalue>
 39              <Hsp_query-from>336</Hsp_query-from>
 40              <Hsp_query-to>1889</Hsp_query-to>
 41              <Hsp_hit-from>25</Hsp_hit-from>
 42              <Hsp_hit-to>542</Hsp_hit-to>
 43              <Hsp_query-frame>3</Hsp_query-frame>
 44              <Hsp_hit-frame>0</Hsp_hit-frame>
 45              <Hsp_identity>518</Hsp_identity>
 46              <Hsp_positive>518</Hsp_positive>
 47              <Hsp_gaps>0</Hsp_gaps>
 48              <Hsp_align-len>518</Hsp_align-len>
 49              <Hsp_qseq>NWFHLLNSGGSALSVMFAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGIKS</Hsp_qseq>
 50              <Hsp_hseq>NWFHLLNSGGSALSVMFAKLVGIIAGISAPIWAVIGVIAALVAGFVLLYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGIKS</Hsp_hseq>
 51              <Hsp_midline>NWFHLLNSGGSALSVMFAKLVGIIAGISAPIWAVIGVIAALVAGFVLLYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGIKS</Hsp_midline>
 52            </Hsp>
 53          </Hit_hsps>
 54        </Hit>
 55        <Hit>
 56          <Hit_num>2</Hit_num>
 57          <Hit_id>gi|289551554|ref|YP_003472458.1|</Hit_id>
 58          <Hit_def>Phage tail length tape-measure protein [Staphylococcus lugdunensis HKU09-01] &gt;gi|289181085|gb|ADC88330.1| Phage tail length tape-measure protein [Staphylococcus lugdunensis HKU09-01]</Hit_def>
 59          <Hit_accession>YP_003472458</Hit_accession>
 60          <Hit_len>1220</Hit_len>
 61          <Hit_hsps>
 62            <Hsp>
 63              <Hsp_num>1</Hsp_num>
 64              <Hsp_bit-score>256.91395450591</Hsp_bit-score>
 65              <Hsp_score>655</Hsp_score>
 66              <Hsp_evalue>5.97108392092708e-66</Hsp_evalue>
 67              <Hsp_query-from>342</Hsp_query-from>
 68              <Hsp_query-to>1889</Hsp_query-to>
 69              <Hsp_hit-from>657</Hsp_hit-from>
 70              <Hsp_hit-to>1106</Hsp_hit-to>
 71              <Hsp_query-frame>3</Hsp_query-frame>
 72              <Hsp_hit-frame>0</Hsp_hit-frame>
 73              <Hsp_identity>170</Hsp_identity>
 74              <Hsp_positive>254</Hsp_positive>
 75              <Hsp_gaps>66</Hsp_gaps>
 76              <Hsp_align-len>516</Hsp_align-len>
 77              <Hsp_qseq>FHLLNSGGSALSVMFAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGIKS</Hsp_qseq>
 78              <Hsp_hseq>FTLLFGKASLVRTVFGLLVGVFTSLSAPVLAVIAVIGSLVAIFVYLWKTNDGFREACINAWNVIKTTVSTVVTVIVAFVKSIWGGLVAWWQQNHVLIQAAATVVWNAIKTVIMTVMNALGPSMKTAWEVIKQAVIIVWEFIKTYVQVAIAVVSGVIKTVMQLITGDWSGAWNTIKQTAMTVWNLIKS-------GATAIFNA----LKVALSAIWNAIKSAASGAWNDMKAVIVAAVNYIKNRVQAQWNTLKAITTGVWNGIKAVISAVWNAIKSFVTSSVSKVKSSVSSGFNSVRNV-------VRSVMSA---------------VKSFISSAWNGVKSIVSGAVGAVKSFVSSGFNAVRNTVSSIMSRVKGIISSI-----------WNSIKSTVSNAVHNMTSA----------------------MSSGMSRMGSAVHSGMSRVSSAVRNGISGAYNAVRGGVYRMVSAGADLARGIARGIMNMAGYVMSRARALASRAVSAIKSALRIHS</Hsp_hseq>
 79              <Hsp_midline>F LL    S +  +F  LVG+   +SAP+ AVI VI +LVA FV L+ TN+ FR     AW  IK+ +ST V  +V+FV  +WG +VAWW +N  LI+  A  VWNAI+TV+ TVM AL P ++TAW++I   V  V   IKT V   + VV G+IK VMQ+I GDWSGAW T+K  A T+W  IKS       G   IF      LK     +W  I +     W+ +K  +  A+  +   +Q    +++     VWN I  V S +W AI + V S ++ +   + +    ++ V       +++V +A               +K  IS+AW  +K+  S    A+ +F+S  +  ++   S+    +K  IS++           WN+IK+++SNA++N+ SA                      +S+G + + S V +   R+ SAVR G   A NA R  +   +S G DL  G   G+   AG ++       S A+   K  L I S</Hsp_midline>
 80            </Hsp>
 81          </Hit_hsps>
 82        </Hit>
 83        <Hit>
 84          <Hit_num>3</Hit_num>
 85          <Hit_id>gi|223044325|ref|ZP_03614360.1|</Hit_id>
 86          <Hit_def>phage tape measure protein [Staphylococcus capitis SK14] &gt;gi|222442293|gb|EEE48403.1| phage tape measure protein [Staphylococcus capitis SK14]</Hit_def>
 87          <Hit_accession>ZP_03614360</Hit_accession>
 88          <Hit_len>1320</Hit_len>
 89          <Hit_hsps>
 90            <Hsp>
 91              <Hsp_num>1</Hsp_num>
 92              <Hsp_bit-score>252.67675917082</Hsp_bit-score>
 93              <Hsp_score>644</Hsp_score>
 94              <Hsp_evalue>1.12609769207128e-64</Hsp_evalue>
 95              <Hsp_query-from>393</Hsp_query-from>
 96              <Hsp_query-to>1889</Hsp_query-to>
 97              <Hsp_hit-from>655</Hsp_hit-from>
 98              <Hsp_hit-to>1193</Hsp_hit-to>
 99              <Hsp_query-frame>3</Hsp_query-frame>
100              <Hsp_hit-frame>0</Hsp_hit-frame>
101              <Hsp_identity>165</Hsp_identity>
102              <Hsp_positive>275</Hsp_positive>
103              <Hsp_gaps>54</Hsp_gaps>
104              <Hsp_align-len>546</Hsp_align-len>
105              <Hsp_qseq>LVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTA---ETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLV---------------QVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVG-------PIWDWIKTT-------VSNAITAVWEIIQNIMTSIQTTW----DTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVS-----------AVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGIKS</Hsp_qseq>
106              <Hsp_hseq>LGGVLAALSGPVGIVIAAVAAVIAIFVALWNSSETLRNALTDAWNAIASSVGAAIQAVLGFLGDLFGRA-------QEILAPLAPMFQQVWSQIVAIVDTAVNVIAPMVKQAFNTVVAVVKVAWEIIKAVIKISMEVILSTIVALLQLLTGDWRGAWQTMSKAGAEIWKAIVEMAKNIWSILGDYLKQSWQNIVDGFSAIFGPLAGIAGSIWNGIVNIVKTVVSGLGAFLTSIWTAIVTSAQVQWSIIATVAQTIWSAIVNVIVTVVTTLVSILATIWTTIVTVASTIWTTLVTVSQTIWTIIVTTITTIVTTLGTILSAIWTGIVTVATTIWTTLVTVAQTIWTLIVTTITTIISTLVTIITTVWTTIVSVTSTIWSSLVAIAQTIWSSVLSIISGIVGVIVAIVTGNWSLLRSSTASIMSGIAGLISAVWNSITSVISSAVSNAVSTAVSGFFNMLSSIGSAMHGIVSSVLSGMMSVVNSVRSGVSNALSAVRNFIGHFTQAGTDLIMGMVNGIKNAAINVVNAAKGVASSAINAVRSVLNSHS</Hsp_hseq>
107              <Hsp_midline>L G++A +S P+  VI  +AA++A FV L+N++E  R  +  AW AI S++  A++AV+ F+ DL+G+        QE++   A   + VW+ I  +V+T +  + P+V+ A++ ++AVV     +IK V+   ++V+L  I A++Q++ GDW GAW+T+      IW+ I  +                Q  +DG   IF        SIW+ +   +  VV         IW  I T+       ++     +W  I N++ ++ TT      T+W  I TVAS IWT + T   ++ T I   I T +  + T+ SA W  I  V   I  T+V +    + LI   I+     + T  + +W  I +  S IW  +   A T W  + + IS ++  I + +   W+ +++S ++ ++ I       WN+I S IS+A+ N  ST  +G+ N++S++ +A   IVS           +VR+G  NA++A RNFI +    G DLI G V G+K AA  +++A  G  S AI+  + +L   S</Hsp_midline>
108            </Hsp>
109            <Hsp>
110              <Hsp_num>2</Hsp_num>
111              <Hsp_bit-score>130.568493605019</Hsp_bit-score>
112              <Hsp_score>327</Hsp_score>
113              <Hsp_evalue>6.45396672852224e-28</Hsp_evalue>
114              <Hsp_query-from>384</Hsp_query-from>
115              <Hsp_query-to>1796</Hsp_query-to>
116              <Hsp_hit-from>844</Hsp_hit-from>
117              <Hsp_hit-to>1309</Hsp_hit-to>
118              <Hsp_query-frame>3</Hsp_query-frame>
119              <Hsp_hit-frame>0</Hsp_hit-frame>
120              <Hsp_identity>101</Hsp_identity>
121              <Hsp_positive>215</Hsp_positive>
122              <Hsp_gaps>79</Hsp_gaps>
123              <Hsp_align-len>508</Hsp_align-len>
124              <Hsp_qseq>FAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVM----QMINGDWSG-------AWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMS-VLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKS--------------------NIETAWNNIKTSISNALNNIKSAAENAWNNIKSAI--STAIENIKSTVSNG---WNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEG</Hsp_qseq>
125              <Hsp_hseq>FSAIFGPLAGIAGSI-------------------------------WNGIVNIVKTVVSGLGAFLTSIWTAIVTSAQVQWSIIATVAQTIWSAIVNVIVTVVTTLVSILATIWTTIVTVASTIWTTLVTVSQTIWTIIVTTITTIVTTLGTILSAIWTGIVTVATTIWTTLVTVAQTIWTLIVTTITTIISTLVTIITTVWTTIVSVTSTIWSSLVAIAQTIWSSVLSIISGIVGVIVAIVTGNWSLLRSSTASIMSGIAGLISAVWNSITSVISSAVSNAVSTAVSGFFNMLSSIGSAMHGIVSSVLSGMMSVV--------NSVRSGVSNALSAVRNFIGHFTQAGTDLIMGMVNGIKNAAINVVNAAKGVASSAINAVRSVLNSHSPSRVMMGIGGDFGEGFKIGIDDKKKSVANIAGGLGSSAVKA---VKNAVNPTDVLSDVRSTLKNSNLKIPNIQGDIKNASASANANITHTHEYKTNPSQRVVTVQMDVNNDALTHIVNG</Hsp_hseq>
126              <Hsp_midline>F+ + G +AGI+  I                               W  I + + T V  + +F+  +W  +V        +I   A+T+W+AI  V+ TV+T L+ I+ T W  I+ V +T+   + TV  T   +++  I  ++     +++  W+G        W TL  VA TIW  I + +   I  LV I  T    + S+  T+W +++A+   IW  + + +S  +  +  I+    + ++++  ++ + I+ + S +W +I++ + S V   +   +  +  ++ ++ SA   I+ +V + ++  +        + ++  +SNA   ++        A T  + G+  GIK AA       K   S+ +  ++S                      +   ++ K S++N    + S+A  A   +K+A+  +  + +++ST+ N      N+   + NA     + +    +   N ++  ++  + V  D +   V G</Hsp_midline>
127            </Hsp>
128          </Hit_hsps>
129        </Hit>
130        <Hit>
131          <Hit_num>4</Hit_num>
132          <Hit_id>gi|268611153|ref|ZP_06144880.1|</Hit_id>
133          <Hit_def>hypothetical protein RflaF_16865 [Ruminococcus flavefaciens FD-1]</Hit_def>
134          <Hit_accession>ZP_06144880</Hit_accession>
135          <Hit_len>1158</Hit_len>
136          <Hit_hsps>
137            <Hsp>
138              <Hsp_num>1</Hsp_num>
139              <Hsp_bit-score>239.194774013712</Hsp_bit-score>
140              <Hsp_score>609</Hsp_score>
141              <Hsp_evalue>1.28842161409548e-60</Hsp_evalue>
142              <Hsp_query-from>78</Hsp_query-from>
143              <Hsp_query-to>1847</Hsp_query-to>
144              <Hsp_hit-from>440</Hsp_hit-from>
145              <Hsp_hit-to>1042</Hsp_hit-to>
146              <Hsp_query-frame>3</Hsp_query-frame>
147              <Hsp_hit-frame>0</Hsp_hit-frame>
148              <Hsp_identity>183</Hsp_identity>
149              <Hsp_positive>291</Hsp_positive>
150              <Hsp_gaps>85</Hsp_gaps>
151              <Hsp_align-len>639</Hsp_align-len>
152              <Hsp_qseq>NLVAGLGQKDADIKGLLSNLGETIQNFVRNVKNVVLTIWDNL-PLAPWQKW----LGLIAVAAGPFLMLLGXXXXXXXXXXXXXXXXXXXXNWFHLLNSGGSALSVMFAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVW-----------NAISTVASNIWTAISTTVMSVLTTIWGYIQT---------------YLELIKTVWSA------------------AWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVS</Hsp_qseq>
153              <Hsp_hseq>NLGGQLTILKSQLQELAISFGEILMPAIRAIVSKIQGFIDKLNAMDPATKETIVKIALVAAALGPLLVVVGKTMVGVGKLMQLVANLPT-------IIAGAKAAFTSFGAAIG---GISAPVVAVIAVVAALVAAFVHLWRTNEDFRNKITAIWNQIKSIFDNFCQGIVDRVNAL--------GFDFKNISEVIKAVWDGL-------CKFLAPVFE-------GVFQQVANIFKAVTD----IILNILDIFVGIFTGDWSRVWDGIKGIFVAVWNFLKDTLKNYLNVLCNLFGTNLDEVKEFWVNVWTSIKNFFVNIWNGIKNFITGVVNAIKNFFTTIWTGIKNFFVGIWTAIYNSVAEKINLIKTVITVVWNAIHTAISMVLNAIWNVISTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHEKITTAWENIKAVVTIVLEAIKSVIETVWNAIHTAITTVMDAISNVISTVWNAISSFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVLNTISSVVSSIWNGIKNTVTNILNTIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLASQAFQWGADIINGIVNGIKNCIGKVADAVKGVAN</Hsp_hseq>
154              <Hsp_midline>NL   L    + ++ L  + GE +   +R + + +    D L  + P  K     + L+A A GP L+++G     +  ++ + + +         + +G  A    F   +G   GISAP+ AVI V+AALVA FV L+ TNE+FR K+ A W  IKS      + +V  V  L          + + I +  + VW+ +          L P+ +        V   V N+ K V D    ++L I+   + +  GDWS  W+ +KG+   +W  +K  ++  ++ L  +F T L  +K  W  VW +I      IW+ IK  ++  + A+      I T I+  +  +W           N I TV + +W AI T +  VL  IW  I T               +  L +T++ A                  AWE IKAV   +L  I  ++   ++ I  AI+   + I    S +WNAI++F+SG+   I +  S+ W  IK  I+N +  I + +   WN I   IS  LN I S   + WN IK+ ++  +  IK+TVSN W+++ + VT     I   +  GF+ AVN  +N  S A   G D+ING V G+K   G++ DAV G  +</Hsp_midline>
155            </Hsp>
156            <Hsp>
157              <Hsp_num>2</Hsp_num>
158              <Hsp_bit-score>141.354081730704</Hsp_bit-score>
159              <Hsp_score>355</Hsp_score>
160              <Hsp_evalue>3.65629455324605e-31</Hsp_evalue>
161              <Hsp_query-from>543</Hsp_query-from>
162              <Hsp_query-to>1856</Hsp_query-to>
163              <Hsp_hit-from>547</Hsp_hit-from>
164              <Hsp_hit-to>938</Hsp_hit-to>
165              <Hsp_query-frame>3</Hsp_query-frame>
166              <Hsp_hit-frame>0</Hsp_hit-frame>
167              <Hsp_identity>103</Hsp_identity>
168              <Hsp_positive>183</Hsp_positive>
169              <Hsp_gaps>52</Hsp_gaps>
170              <Hsp_align-len>441</Hsp_align-len>
171              <Hsp_qseq>ISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNL---VSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAI</Hsp_qseq>
172              <Hsp_hseq>ISAPVVAVIAVVAALVAAFVHLWRTNEDF-RNKITAIWNQIKSIFDNFCQGIVDRVNA-------------------LGFDFKNISEVIKAV-------WDGLCKFLAPVFEGVFQQVANIFKAVTDIILNILDIFVGIFTGDWSRVWDGIKGIFVAVWNFLKDTLKNYLNVLCNLFGTNLDEVKEFWVNVWTSIKNFFVNIWNGIKNFITGVVNAI-----------KNFFTTIWTGIKNFF-------VGIWTAIYNSVAEKIN----LIKTVITVVWNAIHTAISMVLNAIWNVISTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHEKITTAWENIKAVVTIVLEAIKSVIETVWNAIHTAITTVMDAISNVISTVWNAISSFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFI</Hsp_hseq>
173              <Hsp_midline>IS  V AV++ V  L    V  W  N++  R     +WN I+++ +     ++  V                     +    K +  +IKAV       W G  + L  V   +++ + ++ +   D ++ I    +      W  VW  I  +   +W+++K T+ N +  +  +    +  ++  W  VW +I     NIW  I   +  V+  I           K  ++  W  IK  F       VG+ T  ++ + + I+    +IKT  + +WNAI T +S +   I    ST W+ I   IS ++   +   ET +  I   IS  ++ I      AW NIK+ ++  +E IKS +   WN +   ++TV +A   ++S V     + ++   N I + IS   + I   +     A   ++ AV  A+SG I</Hsp_midline>
174            </Hsp>
175            <Hsp>
176              <Hsp_num>3</Hsp_num>
177              <Hsp_bit-score>140.198483002952</Hsp_bit-score>
178              <Hsp_score>352</Hsp_score>
179              <Hsp_evalue>8.14537447802119e-31</Hsp_evalue>
180              <Hsp_query-from>522</Hsp_query-from>
181              <Hsp_query-to>1844</Hsp_query-to>
182              <Hsp_hit-from>722</Hsp_hit-from>
183              <Hsp_hit-to>1121</Hsp_hit-to>
184              <Hsp_query-frame>3</Hsp_query-frame>
185              <Hsp_hit-frame>0</Hsp_hit-frame>
186              <Hsp_identity>116</Hsp_identity>
187              <Hsp_positive>190</Hsp_positive>
188              <Hsp_gaps>77</Hsp_gaps>
189              <Hsp_align-len>459</Hsp_align-len>
190              <Hsp_qseq>WEAIKSAISTAVEAVVSFVMDLW--------GQMVAWWN---ENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSN--GWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLI-----NGFVEGVKGAAGRLIDAVGGAV</Hsp_qseq>
191              <Hsp_hseq>WNGIKNFITGVVNAIKNFFTTIWTGIKNFFVGIWTAIYNSVAEKINLIKTVITVVWNAIHTAISMVLNAIWNVISTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHEKITTAWENIKAVVTIVLEAIKSVIETVWNAI----HTAIT-------TVMDAISNVISTVWNAISSFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAIS-----------GFISGVLNTISSVVSSIWNGIKNTVTNILNTIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNF-------IKNLASQAFQWGADII---------------NGIVNGIKNCIGKVADAVKGVANKIKSFLHFSVPD-EGTLADFESW--------------MPDFMQGLAQGINKSKKYVEKAISGVADAMTIAMNSDFNVDMSGVTGAMVGAGGTTV</Hsp_hseq>
192              <Hsp_midline>W  IK+ I+  V A+ +F   +W        G   A +N   E   LI+     VWNAI T +  V+ A+  ++ T W  I   ++ +L   + + +T  + +  II  VM  I+   + AWE +K V   + E IKS+++   + +     T +        TV   I  V+  +W+ I + +S  + A+W +I +I  SI+       NAI  V S +W AIS           G+I   L  I +V S+ W  IK     IL TI   V+  +D +K A++     IK      +NA   F       IK  AS A++W    I               N I   I N +  +  A +   N IKS +  ++ + + T+++   W              +     G    +N ++ ++  AIS   D +     + F   + G  G ++ A G  V</Hsp_midline>
193            </Hsp>
194            <Hsp>
195              <Hsp_num>4</Hsp_num>
196              <Hsp_bit-score>115.160510568324</Hsp_bit-score>
197              <Hsp_score>287</Hsp_score>
198              <Hsp_evalue>2.80602663410135e-23</Hsp_evalue>
199              <Hsp_query-from>501</Hsp_query-from>
200              <Hsp_query-to>1694</Hsp_query-to>
201              <Hsp_hit-from>770</Hsp_hit-from>
202              <Hsp_hit-to>1144</Hsp_hit-to>
203              <Hsp_query-frame>3</Hsp_query-frame>
204              <Hsp_hit-frame>0</Hsp_hit-frame>
205              <Hsp_identity>100</Hsp_identity>
206              <Hsp_positive>176</Hsp_positive>
207              <Hsp_gaps>39</Hsp_gaps>
208              <Hsp_align-len>406</Hsp_align-len>
209              <Hsp_qseq>RTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWET----LKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENI-KSTVSNGWNNLVSTV---TNAGPRIVS</Hsp_qseq>
210              <Hsp_hseq>KTVITVVWNAIHTAISMVLNAIWNVISTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHEKITTAWENIKAVVTIVLEAIKSVIETVWNAIHTAITTVMDAISNVISTVWNAISSFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVL--------NTISSVVSSIWNGIKNTVTNI-------LNTIKTTVSNIWDSVKNAVTQKITAI-------KDTIVNGFNAAVNFIKNLASQAFQWGADIINGIVNGIKNCIGKVADAVK----GVANKIKSFLHFSVPDEGTLAD-----FESWMPDFMQGLAQGINKSKKYVEKAISGVADAMTIAMNSDFNVDMSGVTGAMVGAGGTTVVNNYNNDNSRTVNQTNNSPKSLS</Hsp_hseq>
211              <Hsp_midline>+T +   W AI +AIS  + A+ + +  +W  +  + +   E  R   ET++ AI  ++  VM  +   + TAW+ I AVVT VL  IK+V++T    +   I  VM  I+   S  W      + GV   IW  I S+     D +        A + ++W+ + G I  V+         T+S+ ++++W  I+N +T+I        N I T  SNIW ++   V   +T I        + I   ++AA   IK + +        ++ G  + IK  I    + +K     + N I +FL        T A       ++ + + M  +   I  +   ++ +IS   + +  A  + +N   S ++ A+     +TV N +NN  S     TN  P+ +S</Hsp_midline>
212            </Hsp>
213            <Hsp>
214              <Hsp_num>5</Hsp_num>
215              <Hsp_bit-score>90.8929372855311</Hsp_bit-score>
216              <Hsp_score>224</Hsp_score>
217              <Hsp_evalue>5.66707902872949e-16</Hsp_evalue>
218              <Hsp_query-from>492</Hsp_query-from>
219              <Hsp_query-to>1148</Hsp_query-to>
220              <Hsp_hit-from>811</Hsp_hit-from>
221              <Hsp_hit-to>1044</Hsp_hit-to>
222              <Hsp_query-frame>3</Hsp_query-frame>
223              <Hsp_hit-frame>0</Hsp_hit-frame>
224              <Hsp_identity>67</Hsp_identity>
225              <Hsp_positive>106</Hsp_positive>
226              <Hsp_gaps>29</Hsp_gaps>
227              <Hsp_align-len>241</Hsp_align-len>
228              <Hsp_qseq>EEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDT-----------GLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWD-----------WIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNI</Hsp_qseq>
229              <Hsp_hseq>EAFRYLFETIFEAIHVIISRVMDWIHEKITTAWENIKAVVTIVLEAIKSVIETVWNAIHTAITTVMDAISNVISTVWNAISSFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVLNTISSVVSSIWNGIKNTV-------TNILNTIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLASQAFQWGADIINGIVNGIKNCIGKVADAVKGVANKI</Hsp_hseq>
230              <Hsp_midline>E FR   +  +EAI   IS  ++ +   +   W  + A      E I+   ETVWNAI T + TVM A+  ++ T W+ I + ++ V+N I +V+ +            L  +  ++ AV   I+G  SG   T+  V  +IW GIK+ V         I  T    + +IWD+V   +   +  I D           +IK   S A     +II  I+  I+     V +A+  VA+ I</Hsp_midline>
231            </Hsp>
232            <Hsp>
233              <Hsp_num>6</Hsp_num>
234              <Hsp_bit-score>51.9877801178785</Hsp_bit-score>
235              <Hsp_score>123</Hsp_score>
236              <Hsp_evalue>0.000291728300853117</Hsp_evalue>
237              <Hsp_query-from>1158</Hsp_query-from>
238              <Hsp_query-to>1883</Hsp_query-to>
239              <Hsp_hit-from>547</Hsp_hit-from>
240              <Hsp_hit-to>775</Hsp_hit-to>
241              <Hsp_query-frame>3</Hsp_query-frame>
242              <Hsp_hit-frame>0</Hsp_hit-frame>
243              <Hsp_identity>50</Hsp_identity>
244              <Hsp_positive>102</Hsp_positive>
245              <Hsp_gaps>35</Hsp_gaps>
246              <Hsp_align-len>253</Hsp_align-len>
247              <Hsp_qseq>ISTTVMSVLTTIWGYIQTYLELIKT------VWSAAWEIIKAVFAAILLTIVGLVTG-NFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTI----KSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGI</Hsp_qseq>
248              <Hsp_hseq>ISAPVVAVIAVVAALVAAFVHLWRTNEDFRNKITAIWNQIKSIFDNFCQGIVDRVNALGFDF-----KNISEVIKA----VWDGLCKFLAPVFEGVFQQVANIFKAVTDIILNILDIFVGIFTGDWSRVWDGIKGIFVAVWNFLKDTLKNYLNVLCNLFGTNLDEVKEFWVNVW---------------TSIKNFFVNIWNGIKNFITGVVNAIKNFFTTIWTGIKNFFVGIWTAIYNSVAEKINLIKTVITV</Hsp_hseq>
249              <Hsp_midline>IS  V++V+  +   +  ++ L +T        +A W  IK++F      IV  V    FD       N  E+IK     +W+ +  FL+ ++EG+    +  ++ +   I N++         +    W+ IK       N +K   +N  N + +   T ++ +K    N W               ++++  F N  N  +NFI+  ++   +       G+K     +  A+  +V+  I+  K ++ +</Hsp_midline>
250            </Hsp>
251          </Hit_hsps>
252        </Hit>
253        <Hit>
254          <Hit_num>5</Hit_num>
255          <Hit_id>gi|268610688|ref|ZP_06144415.1|</Hit_id>
256          <Hit_def>hypothetical protein RflaF_14482 [Ruminococcus flavefaciens FD-1]</Hit_def>
257          <Hit_accession>ZP_06144415</Hit_accession>
258          <Hit_len>1444</Hit_len>
259          <Hit_hsps>
260            <Hsp>
261              <Hsp_num>1</Hsp_num>
262              <Hsp_bit-score>234.572379102704</Hsp_bit-score>
263              <Hsp_score>597</Hsp_score>
264              <Hsp_evalue>3.17349283264528e-59</Hsp_evalue>
265              <Hsp_query-from>78</Hsp_query-from>
266              <Hsp_query-to>1847</Hsp_query-to>
267              <Hsp_hit-from>440</Hsp_hit-from>
268              <Hsp_hit-to>1042</Hsp_hit-to>
269              <Hsp_query-frame>3</Hsp_query-frame>
270              <Hsp_hit-frame>0</Hsp_hit-frame>
271              <Hsp_identity>185</Hsp_identity>
272              <Hsp_positive>294</Hsp_positive>
273              <Hsp_gaps>85</Hsp_gaps>
274              <Hsp_align-len>639</Hsp_align-len>
275              <Hsp_qseq>NLVAGLGQKDADIKGLLSNLGETIQNFVRNVKNVVLTIWDNL-PLAPWQKW----LGLIAVAAGPFLMLLGXXXXXXXXXXXXXXXXXXXXNWFHLLNSGGSALSVMFAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVS-------NAITAVWEIIQN----IMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQT---------------YLELIKTVWSA------------------AWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVS</Hsp_qseq>
276              <Hsp_hseq>NLGGQLTILKSQLQELAISFGEILMPAIRSIVSRIQGLIDKFNALSPATKETIVKVALVAATLGPLLVVVGKTMVGVGKLMQLVA------NLPTIIASAKAA----FTSFGAAIGGISAPVVAVIAVVAALVAAFVHLWRTNEDFRNKITAIWEQIKSIFSGFCQGIVDRINALGFDF---------------KNITEVIKAVWDGLCKFLKPIFEGQFQ-------QIANIFKAVTD----IILSVLDIFVGIFTGDWSRVWDGIKGIFVAVWNFIKDTLKNALNMICGIFGTDLGEVKEFWVGVWTSIKNFFVNIWNGIKNFISSVLGGIKNFFTTIWTGIKNFFVGIWTAIYSSVSEKINLIKTVITVVWNAIHTAISTVLNAIWSVITTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHDKIVERWETIKAIVTVVLEAIKSVIETVWNAIHTAISTVMDAIHNVVSTVWNAISGFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVLNTISSVVSSIWNGIKNTVTNILNAIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLGSQAFQWGADIINNIVSGIKNCIGKVADAVKGVAN</Hsp_hseq>
277              <Hsp_midline>NL   L    + ++ L  + GE +   +R++ + +  + D    L+P  K     + L+A   GP L+++G     +  ++ + +      N   ++ S  +A    F      I GISAP+ AVI V+AALVA FV L+ TNE+FR K+ A WE IKS  S   + +V  +  L                   + +   I+ V + +   L PI +  +         + N+ K V D    ++L ++   + +  GDWS  W+ +KG+   +W  IK  ++ A++ +  IF T L  +K  W  VW +I      IW+ IK  +S       N  T +W  I+N    I T+I ++     N I TV + +W AI T + +VL  IW  I T               +  L +T++ A                   WE IKA+   +L  I  ++   ++ I  AIS   + I    S +WNAI+ F+SG+   I +  S+ W  IK  I+N +  I + +   WN I   IS  LN I S   + WN IK+ ++  +  IK+TVSN W+++ + VT     I   +  GF+ AVN  +N  S A   G D+IN  V G+K   G++ DAV G  +</Hsp_midline>
278            </Hsp>
279            <Hsp>
280              <Hsp_num>2</Hsp_num>
281              <Hsp_bit-score>167.932852469002</Hsp_bit-score>
282              <Hsp_score>424</Hsp_score>
283              <Hsp_evalue>3.64782449590402e-39</Hsp_evalue>
284              <Hsp_query-from>501</Hsp_query-from>
285              <Hsp_query-to>1856</Hsp_query-to>
286              <Hsp_hit-from>770</Hsp_hit-from>
287              <Hsp_hit-to>1245</Hsp_hit-to>
288              <Hsp_query-frame>3</Hsp_query-frame>
289              <Hsp_hit-frame>0</Hsp_hit-frame>
290              <Hsp_identity>121</Hsp_identity>
291              <Hsp_positive>216</Hsp_positive>
292              <Hsp_gaps>54</Hsp_gaps>
293              <Hsp_align-len>491</Hsp_align-len>
294              <Hsp_qseq>RTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWET----LKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLT----TIWGYIQTYLELIKTVWSAAW----EIIKAVFAAI---LLTIVGLVTGNFDLIKQ------------AISNAW---------EIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGW---NNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAI</Hsp_qseq>
295              <Hsp_hseq>KTVITVVWNAIHTAISTVLNAIWSVITTVWQTIYDFISPLLEAFRYLFETIFEAIHVIISRVMDWIHDKIVERWETIKAIVTVVLEAIKSVIETVWNAIHTAISTVMDAIHNVVSTVWNAISGFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVL--------NTISSVVSSIWNGIKNTVTNI-------LNAIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLGSQAFQWGADIINNIVSGIKNCIGKVADAVKGVANKIKSFLHFSVPDEGPLADFESWMPDFMQGLADGINANTSVVNDAVNSFAGGLAEKISSVIQNALSNVVTSVQGFMTQVFDTVKTVWTNANAAIDATMSQISSGITSGWKTIVSTIKTALENIRNVITTTWKAVSSVISAALDGIKKIVTVVWTALKNLIKTGQLDIKSVVTTTWEAVSGVVRTAVNAIKSVVQAVWDAMPDTV</Hsp_hseq>
296              <Hsp_midline>+T +   W AI +AIST + A+ S +  +W  +  + +   E  R   ET++ AI  ++  VM  +   +   W+ I A+VT VL  IK+V++T    +   I  VM  I+   S  W      + GV   IW  I S+     D +        A + ++W+ + G I  V+         T+S+ ++++W  I+N +T+I        NAI T  SNIW ++   V   +T    TI       +  IK + S A+    +II  + + I   +  +   V G  + IK             A   +W         + I   TS + +A+ +F  G+ E I +    A   + T++   MT +   ++T W N   +I   ++ I S   + W  I S I TA+ENI++ ++  W   ++++S   +   +IV+ V T   N +   +  I + ++   + ++G V     A   ++ AV  A+   +</Hsp_midline>
297            </Hsp>
298            <Hsp>
299              <Hsp_num>3</Hsp_num>
300              <Hsp_bit-score>161.769659254324</Hsp_bit-score>
301              <Hsp_score>408</Hsp_score>
302              <Hsp_evalue>2.61420693292496e-37</Hsp_evalue>
303              <Hsp_query-from>492</Hsp_query-from>
304              <Hsp_query-to>1832</Hsp_query-to>
305              <Hsp_hit-from>811</Hsp_hit-from>
306              <Hsp_hit-to>1322</Hsp_hit-to>
307              <Hsp_query-frame>3</Hsp_query-frame>
308              <Hsp_hit-frame>0</Hsp_hit-frame>
309              <Hsp_identity>123</Hsp_identity>
310              <Hsp_positive>220</Hsp_positive>
311              <Hsp_gaps>75</Hsp_gaps>
312              <Hsp_align-len>517</Hsp_align-len>
313              <Hsp_qseq>EEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDT-----------GLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAI--------------------------DGLVQIFQTGLAFLKSIWDTV--WGT---------IMAVVGPIWDWIKTTVSNAITAV----------------W--EIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMS----VLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAV</Hsp_qseq>
314              <Hsp_hseq>EAFRYLFETIFEAIHVIISRVMDWIHDKIVERWETIKAIVTVVLEAIKSVIETVWNAIHTAISTVMDAIHNVVSTVWNAISGFISGVVNAIWSVISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVLNTISSVVSSIWNGIKNTVTNILNAIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLGSQAFQWGADIINNIVSGIKNCIGKVADAVKG-VANKIKSFLHFSVPDEGPLADFESWMPDFMQGLADGINANTSVVNDAVNSFAGGLAEKISSVIQNALSNVVTSVQGFMTQVFDTVKTVWTNA----NAAIDATMSQISSGITSGWKTIVSTIKTALENIRNVITTTWKAVSSVISAALDGIKKIVTVVWTALKNLIKTGQLDIKSVVTTTWEAVSGVVRTAVNAIKSVVQAVWDAMPDTVRSAMNRVKEAVLSIWDGIKSGIGDRLGGVRDAVVNAMNAVYKAVKDKVNSSWSWGRDLMQNLINGITYMLGSLINTV</Hsp_hseq>
315              <Hsp_midline>E FR   +  +EAI   IS  ++ +   +++ W  + A      E I+   ETVWNAI T + TVM A+  +V T W+ I   ++ V+N I +V+ +            L  +  ++ AV   I+G  SG   T+  V  +IW GIK+ V   +                          D +V  F   + F+K++      WG          I   +G + D +K  V+N I +                 W  + +Q +   I      V +A+++ A  +   IS+ + +    V+T++ G++    + +KTVW+ A     A   A +  I   +T  +  I   I  A E I+   +  W A+++ +S   +GIK   +  W  +K  I      IKS + T W  +   +  A+N IKS  +  W+ +   + +A+  +K  V + W+ + S + +    +  AV    +    A ++ ++++ S G DL+   + G+    G LI+ V</Hsp_midline>
316            </Hsp>
317            <Hsp>
318              <Hsp_num>4</Hsp_num>
319              <Hsp_bit-score>123.249701662589</Hsp_bit-score>
320              <Hsp_score>308</Hsp_score>
321              <Hsp_evalue>1.03039235764918e-25</Hsp_evalue>
322              <Hsp_query-from>510</Hsp_query-from>
323              <Hsp_query-to>1859</Hsp_query-to>
324              <Hsp_hit-from>905</Hsp_hit-from>
325              <Hsp_hit-to>1377</Hsp_hit-to>
326              <Hsp_query-frame>3</Hsp_query-frame>
327              <Hsp_hit-frame>0</Hsp_hit-frame>
328              <Hsp_identity>108</Hsp_identity>
329              <Hsp_positive>204</Hsp_positive>
330              <Hsp_gaps>63</Hsp_gaps>
331              <Hsp_align-len>493</Hsp_align-len>
332              <Hsp_qseq>VQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAV--------MQMINGDWSG-------AWETLKGVAGTIWEGIKSLVQVAI--DGLVQIFQTGLA-FLKSIWD-------TVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVT------------GNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLIN------GFVEGVKGAAGRLIDAVGGAVSGAID</Hsp_qseq>
333              <Hsp_hseq>ISSIWNSIKDHITNTLNAIHAVVSAVWNAISGFISGVLNTISSVVSSIWNGIKNTVTNILNAIKTTVSNIWDSVKNAVTQKITAIKDTIVNGFNAAVNFIKNLGSQAFQWGADIINNIVSGIKNCIGKVADAVKGVANKI----KSFLHFSVPDEGPLADFESWMPDFMQGLADGINANTSVVNDAVNSFAGGLAEKISSVIQNALSNVVTSVQGFMTQVFDTVKTVWTNANAAIDATMSQISSGITSGWKTIVSTIKTALENIRNVITTTWKAVSSVISAALDGIKKIVTVVWTALKNLIKTGQLD-IKSVVTTTWEAVSGVVRTAVNA-----------IKSVVQAVWDAMPDTVRSAMNRVKEAVLSIWDGIKSGIGDRLGGVRDAVVNAMNAVYKAVKDKVNSSWSWGRDLMQNLINGITYMLGSLINTVA----DVARSIWEYLHFSVPEKGALTDVEEWMPDFMKGLAKGINKSKKYVEAAVSGVAD</Hsp_hseq>
334              <Hsp_midline>+ + W +IK  I+  + A+ + V  +W  +  + +     I     ++WN I+  V  ++ A+   V   WD +   VT  +  IK  +  G    +  IK +          +IN   SG         + +KGVA  I    KS +  ++  +G +  F++ +  F++ + D        V   + +  G + + I + + NA++ V   +Q  MT +  T  TVW   +       + IS+ + S   TI   I+T LE I+ V +  W+ + +V +A L  I  +VT            G  D IK  ++  WE +        NA           IK+     W+ +  T+ + M  +K  + + W+ IK+ I + L  ++ A  NA N +  A+   + +  S   +   NL++ +T     +++ V     +   +   ++  ++   G L +       F++G+     +    V  AVSG  D</Hsp_midline>
335            </Hsp>
336            <Hsp>
337              <Hsp_num>5</Hsp_num>
338              <Hsp_bit-score>71.6329584896635</Hsp_bit-score>
339              <Hsp_score>174</Hsp_score>
340              <Hsp_evalue>3.55787431696712e-10</Hsp_evalue>
341              <Hsp_query-from>486</Hsp_query-from>
342              <Hsp_query-to>1343</Hsp_query-to>
343              <Hsp_hit-from>1138</Hsp_hit-from>
344              <Hsp_hit-to>1400</Hsp_hit-to>
345              <Hsp_query-frame>3</Hsp_query-frame>
346              <Hsp_hit-frame>0</Hsp_hit-frame>
347              <Hsp_identity>60</Hsp_identity>
348              <Hsp_positive>128</Hsp_positive>
349              <Hsp_gaps>35</Hsp_gaps>
350              <Hsp_align-len>292</Hsp_align-len>
351              <Hsp_qseq>TNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTV--MSVLTTIWGYIQTYLELIKTVWSAAWEIIKA----VFAAILLTIVGLVTGNFDLIKQAISN</Hsp_qseq>
352              <Hsp_hseq>TMSQISSGITSGWKTIVSTIKTALENIRNVITTTWKAVSSVISAALDGIKKIVTVVWTALKNLIKTGQLDIKSVVTTTWEAVSGVVRTAVNAIKSVV-----------QAVWDAMPDTVRSAMNRVKEAVLSIWDGIKSGIGDRLGGVRDAVVNAM-------NAVYKAVKDKVNSSWSWGR-----------DLMQNLINGITYMLGSLINTVADVARSIWEYLHFSVPEKGALTDVEEWMPDFMKGLAKGINKSKKYVEAAVSGVADAMTLTMQSGLNVDMDGISGAMMN</Hsp_hseq>
353              <Hsp_midline>T  +  + + + W+ I S I TA+E + + +   W  + +  +   + I++    VW A++ +++T    +  +V T W+ +  VV T +N IK+VV           +AV   +      A   +K    +IW+GIKS +   + G+       +       + V+  +   V   W W +           +++QN++  I     ++ N ++ VA +IW  +  +V     LT +  ++  +++ +    + + + ++A    V  A+ LT+   +  + D I  A+ N</Hsp_midline>
354            </Hsp>
355            <Hsp>
356              <Hsp_num>6</Hsp_num>
357              <Hsp_bit-score>53.9137779974652</Hsp_bit-score>
358              <Hsp_score>128</Hsp_score>
359              <Hsp_evalue>7.67706873813937e-05</Hsp_evalue>
360              <Hsp_query-from>894</Hsp_query-from>
361              <Hsp_query-to>1883</Hsp_query-to>
362              <Hsp_hit-from>467</Hsp_hit-from>
363              <Hsp_hit-to>775</Hsp_hit-to>
364              <Hsp_query-frame>3</Hsp_query-frame>
365              <Hsp_hit-frame>0</Hsp_hit-frame>
366              <Hsp_identity>73</Hsp_identity>
367              <Hsp_positive>133</Hsp_positive>
368              <Hsp_gaps>43</Hsp_gaps>
369              <Hsp_align-len>341</Hsp_align-len>
370              <Hsp_qseq>IKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKT------VWSAAWEIIKAVFAAILLTIVGLVTG-NFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTI----KSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVSGAIDWAKGLLGI</Hsp_qseq>
371              <Hsp_hseq>IRSIVS-RIQGLIDKFNALSPATKETIVKV-ALVAATLGPLLVVVGKTMVG-VGKLMQLVANLPTIIASA-----KAAFTSFGAAIGGISAPVVAVIAVVAALVAAFVHLWRTNEDFRNKITAIWEQIKSIFSGFCQGIVDRINALGFDF-----KNITEVIKA----VWDGLCKFLKPIFEGQFQQIANIFKAVTDIILSVLDIFVGIFTGDWSRVWDGIKGIFVAVWNFIKDTLKNALNMICGIFGTDLGEVKEFWVGVW---------------TSIKNFFVNIWNGIKNFISSVLGGIKNFFTTIWTGIKNFFVGIWTAIYSSVSEKINLIKTVITV</Hsp_hseq>
372              <Hsp_midline>I+S+V   I GL+  F       K     V   + A +GP+   +  T+   +  + +++ N+ T I +       A  T        IS  V++V+  +   +  ++ L +T        +A WE IK++F+     IV  +    FD       N  E+IK     +W+ +  FL  I+EG     +  ++ +   I +V+         +    W+ IK       N IK   +NA N I     T +  +K      W               ++++  F N  N  +NFIS+ +    +       G+K     +  A+  +VS  I+  K ++ +</Hsp_midline>
373            </Hsp>
374          </Hit_hsps>
375        </Hit>
376        <Hit>
377          <Hit_num>6</Hit_num>
378          <Hit_id>gi|153811333|ref|ZP_01964001.1|</Hit_id>
379          <Hit_def>hypothetical protein RUMOBE_01725 [Ruminococcus obeum ATCC 29174] &gt;gi|149832460|gb|EDM87544.1| hypothetical protein RUMOBE_01725 [Ruminococcus obeum ATCC 29174]</Hit_def>
380          <Hit_accession>ZP_01964001</Hit_accession>
381          <Hit_len>1228</Hit_len>
382          <Hit_hsps>
383            <Hsp>
384              <Hsp_num>1</Hsp_num>
385              <Hsp_bit-score>219.934795217844</Hsp_bit-score>
386              <Hsp_score>559</Hsp_score>
387              <Hsp_evalue>8.08889755547188e-55</Hsp_evalue>
388              <Hsp_query-from>108</Hsp_query-from>
389              <Hsp_query-to>1847</Hsp_query-to>
390              <Hsp_hit-from>493</Hsp_hit-from>
391              <Hsp_hit-to>1073</Hsp_hit-to>
392              <Hsp_query-frame>3</Hsp_query-frame>
393              <Hsp_hit-frame>0</Hsp_hit-frame>
394              <Hsp_identity>176</Hsp_identity>
395              <Hsp_positive>285</Hsp_positive>
396              <Hsp_gaps>81</Hsp_gaps>
397              <Hsp_align-len>621</Hsp_align-len>
398              <Hsp_qseq>ADIKGLLSNLGETIQNFVRNVKNVVLTIWDNL-PLAPWQKW----LGLIAVAAGPFLMLLGXXXXXXXXXXXXXXXXXXXXNWFHLLNSGGSALSVMFAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKT-------TVSNAITAVWE-IIQNI---MTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELI----KTVWS-------AAWEIIK-AVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIW------------EGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTS-ISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAISVGGDLINGFVEGVKGAAGRLIDAVGGAVS</Hsp_qseq>
399              <Hsp_hseq>SQLQELAISFGEILMPKIRDIVTHIQNFVDKLNAMDEGQKETILRIGMFVAALAPMLMGLGKVITFSANVSRALGTLSAG-----LVKAGG--FSGVFTKALGLI---TSPAAIVVGVIAAITAVIIHLWNTNEDFRNTITAIWQKIKDAFTTFAAGI---------------SERLSALGITFSDVTSAIKTIWDGFCNLLAPVLEAAFSTIAIALQTAFNVI-----------LGIWDVFSAVFSGDWSGAWEAIKGIFSSIWDGLKEYFSTIIGAVKGVADVFLGWFGTNWETVWNGVKTFFEGIWNGISSFFEGIWNGISTFCTTVWNGIVTNVTAFCTTVHDTISTIFNAVKDVVSNVWETIKNVVQVAIMFIVEVVKAAFELITVPFRFIWENCRDTIISVWETIKSAVQTAINFVKDNIITPVMNAISATITTVWNAIQTTFTTVINAIKSAVQTAWNFMKDNVVTPVMNAISTTISTVWNTIKTTFTTVINAIKSAVQTAWNFMKNSVITPVMNGIKTVITTVWNAIKTAVQTVVNAIKTTVQTVFNAVKTTVTT----IWNAIKTGTSTAWNAVKTAVTTPINAAKSAVTSAINGIKSTISSVWNSVKSATS</Hsp_hseq>
400              <Hsp_midline>+ ++ L  + GE +   +R++   +    D L  +   QK     +G+   A  P LM LG +    + V      +S       L+ +GG   S +F K +G+I   ++P   V+GVIAA+ A  + L+NTNE+FR  + A W+ IK A +T    +               +E    +  T   V +AI+T+ +     L P+++ A+  I   + T  NVI           LGI      + +GDWSGAWE +KG+  +IW+G+K      I  +  +    L +  + W+TVW  +      IW+ I +        +S   T VW  I+ N+    T++  T  T++NA+  V SN+W  I   V   +  I   ++   ELI    + +W        + WE IK AV  AI      ++T   + I   I+  W  I+T  + + NAI + +   W              I T  ST W  IKTT + V+  IKS ++TAWN +K S I+  +N IK+     WN IK+A+ T +  IK+TV   +N + +TVT     I +A++TG   A NA +  ++  I+     +   + G+K     + ++V  A S</Hsp_midline>
401            </Hsp>
402            <Hsp>
403              <Hsp_num>2</Hsp_num>
404              <Hsp_bit-score>195.667221935051</Hsp_bit-score>
405              <Hsp_score>496</Hsp_score>
406              <Hsp_evalue>1.63364171761813e-47</Hsp_evalue>
407              <Hsp_query-from>519</Hsp_query-from>
408              <Hsp_query-to>1760</Hsp_query-to>
409              <Hsp_hit-from>709</Hsp_hit-from>
410              <Hsp_hit-to>1099</Hsp_hit-to>
411              <Hsp_query-frame>3</Hsp_query-frame>
412              <Hsp_hit-frame>0</Hsp_hit-frame>
413              <Hsp_identity>127</Hsp_identity>
414              <Hsp_positive>197</Hsp_positive>
415              <Hsp_gaps>51</Hsp_gaps>
416              <Hsp_align-len>428</Hsp_align-len>
417              <Hsp_qseq>AWEAIKSAISTAVEAVVSFVMDLWGQM-------VAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWE-IIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQT-----YLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKT-SEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSNGWNNLVSTVTNAGPRIVSAVRTGFDNAVNAARNFISNAIS</Hsp_qseq>
418              <Hsp_hseq>AWEAIKGIFSSIWDGLKEYFSTIIGAVKGVADVFLGWFGTNWE-------TVWNGVKTFFEGIWNGISSFFEGIWNGISTFCTTVWNGIVTNVTAFCTTVHDTISTIFNAV-----------KDVVSNVWETIKNVVQVAIMFIVEVVKAAFELITVPFRFIWENCRDTIISVWETIKSAVQTAINFVKDNIITPVMNAISATITTVWNAIQTT----FTTVINAIKSAVQTAWNFMKDNVVTPVMNAISTTISTVWNTIKTTFTTVI-----------NAIKSAVQTAWNFMKNSVITPVMNGIKTVITTVWNAIKTAVQTVVNAIKTTVQTVFNAVKTTVTTIWNAIKTGTSTAWNAVKTAVTTPINAAKSAVTSAINGIKSTISSVWNSVKSATSSTWNAIKRAITT----PINAAKTAVGNAIS</Hsp_hseq>
419              <Hsp_midline>AWEAIK   S+  + +  +   + G +       + W+  N E       TVWN ++T  E +   +    +  W+ I    TTV N I T V      V   I  +   +           K V   +WE IK++VQVAI  +V++ +     +   +  +W      +  +W+ IK+ V  AI  V + II  +M +I  T  TVWNAI T     +T +   + S + T W +++       +  I T  S  W  IK  F  ++           + IK A+  AW  +K    + + N I T ++ +W  IKTA  T    IKTT+  V   +K+ + T WN IKT  S A N +K+A     N  KSA+++AI  IKST+S+ WN++ S  ++    I  A+ T     +NAA+  + NAIS</Hsp_midline>
420            </Hsp>
421            <Hsp>
422              <Hsp_num>3</Hsp_num>
423              <Hsp_bit-score>169.473650772671</Hsp_bit-score>
424              <Hsp_score>428</Hsp_score>
425              <Hsp_evalue>1.25373984602686e-39</Hsp_evalue>
426              <Hsp_query-from>498</Hsp_query-from>
427              <Hsp_query-to>1640</Hsp_query-to>
428              <Hsp_hit-from>746</Hsp_hit-from>
429              <Hsp_hit-to>1096</Hsp_hit-to>
430              <Hsp_query-frame>3</Hsp_query-frame>
431              <Hsp_hit-frame>0</Hsp_hit-frame>
432              <Hsp_identity>115</Hsp_identity>
433              <Hsp_positive>178</Hsp_positive>
434              <Hsp_gaps>50</Hsp_gaps>
435              <Hsp_align-len>391</Hsp_align-len>
436              <Hsp_qseq>FRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLK-SIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWD--------TVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIK-TVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWNAITTFLSGIWEGIKTAASTAWEWIKTTISNVMTTIKSNIETAWNNIKTSISNALNNIKSAAENAWNNIKSAISTAIENIKSTVSN</Hsp_qseq>
437              <Hsp_hseq>FGTNWETVWNGVKTFFEGIWNGISSFFEGIWNGISTF-----------CTTVWNGIVTNVTAFCTTVHDTISTIFNAVKDVVSNVWETIKNVVQVAIMFIVEVVKAAFELITVPFRFIWENCRDTIISVWETIKSAVQTAIN-----------FVKDNIITPVMNAISATITTVWNAIQTTFTTVINA-------IKSAVQTAWNFMKDNVVTPVMNAISTTISTVWNTIKTTFTTVINAIKSAVQTAWNFMKNSVITPVMNGIKTVITTVWNAIKTAVQTVVNAIKTTVQTVFNAVKTTVTTIWNA-----------IKTGTSTAWNAVKTAVTTPINAAKSAVTSAINGIKSTISSVWNSVKSATSSTWNAIKRAITTPINAAKTAVGN</Hsp_hseq>
438              <Hsp_midline>F T  +  W  +K+        + SF   +W  +  +             TVWN I T V    T +   + T ++ +  VV+ V   IK VV   +  ++ ++KA  ++I   +   WE  +    ++WE IKS VQ AI+           F+K +I   V   I A +  +W+ I+TT +  I A       I +++QT W+         V NAIST  S +W  I TT  +V+  I   +QT    +K +V +     IK V   +   I   V    + IK  +   +  +KT  + IWNA           IKT  STAW  +KT ++  +   KS + +A N IK++IS+  N++KSA  + WN IK AI+T I   K+ V N</Hsp_midline>
439            </Hsp>
440            <Hsp>
441              <Hsp_num>4</Hsp_num>
442              <Hsp_bit-score>118.242107175663</Hsp_bit-score>
443              <Hsp_score>295</Hsp_score>
444              <Hsp_evalue>3.31465838308759e-24</Hsp_evalue>
445              <Hsp_query-from>492</Hsp_query-from>
446              <Hsp_query-to>1256</Hsp_query-to>
447              <Hsp_hit-from>854</Hsp_hit-from>
448              <Hsp_hit-to>1111</Hsp_hit-to>
449              <Hsp_query-frame>3</Hsp_query-frame>
450              <Hsp_hit-frame>0</Hsp_hit-frame>
451              <Hsp_identity>71</Hsp_identity>
452              <Hsp_positive>119</Hsp_positive>
453              <Hsp_gaps>23</Hsp_gaps>
454              <Hsp_align-len>268</Hsp_align-len>
455              <Hsp_qseq>EEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVETVMTALIPIVQTAWDLILA-VVTTVLNVIKTVVDTGLKVVLGIIKAVMQMINGDWSGAWETLKG------------VAGTIWEGIKSLVQVAIDGLVQIFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEI</Hsp_qseq>
456              <Hsp_hseq>ENCRDTIISVWETIKSAVQTAINFVKDNII----------TPVMNAISATITTVWNAIQTTFTTVINAIKSAVQTAWNFMKDNVVTPVMNAISTTISTVWNTIKTTFTTVINAIKSAVQTAWNFMKNSVITPVMNGIKTVITTVWNAIKTAVQTVVNAIKTTVQTVFNAVKTTVTTIWNAIKTGTSTAWNAVKTAVTTPINAAKSAVTSAINGIKSTISSVWNSVKSATSSTWNAIKRAITTPINAAKTAVGNAISAIRSKFNFSWSL</Hsp_hseq>
457              <Hsp_midline>E  R  + + WE IKSA+ TA+  V   ++                I  T  TVWNAI+T   TV+ A+   VQTAW+ +   VVT V+N I T + T    +      V+  I      AW  +K             V  T+W  IK+ VQ  ++ +    QT    +K+   T+W  I       W+ +KT V+  I A    + + +  I++T  +VWN++ +  S+ W AI   + + +      +   +  I++ ++ +W +</Hsp_midline>
458            </Hsp>
459            <Hsp>
460              <Hsp_num>5</Hsp_num>
461              <Hsp_bit-score>116.316109296076</Hsp_bit-score>
462              <Hsp_score>290</Hsp_score>
463              <Hsp_evalue>1.25956884194974e-23</Hsp_evalue>
464              <Hsp_query-from>510</Hsp_query-from>
465              <Hsp_query-to>1385</Hsp_query-to>
466              <Hsp_hit-from>816</Hsp_hit-from>
467              <Hsp_hit-to>1110</Hsp_hit-to>
468              <Hsp_query-frame>3</Hsp_query-frame>
469              <Hsp_hit-frame>0</Hsp_hit-frame>
470              <Hsp_identity>83</Hsp_identity>
471              <Hsp_positive>132</Hsp_positive>
472              <Hsp_gaps>25</Hsp_gaps>
473              <Hsp_align-len>306</Hsp_align-len>
474              <Hsp_qseq>VQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIRTVVET------------VMTALIPIVQTAWDLILAVVTTVLNVIKTVVDTGLKVVL-GIIKAVMQMINGDWSGAWETLKGVAGTIWEGIKSLVQVAIDGLVQ-IFQTGLAFLKSIWDTVWGTIMAVVGPIWDWIKTTVSNAITAVWEIIQNIMTSIQTTWDTVWNAISTVASNIWTAISTTVMSVLTTIWGYIQTYLELIKTVWSAAWEIIKAVFAAILLTIVGLVTGNFDLIKQAISNAWEIIKTKTSEIWN</Hsp_qseq>
475              <Hsp_hseq>VSNVWETIKNVVQVAIMFIVEVVKAAFELITVPFRFIWENCRDTIISVWETIKSAVQTAINFVKDNIITPVMNAISATITTVWNAIQTTFTTVINAIKSAVQTAWNFMKDNVVTPVMNAISTTISTVWNTIKTTFTTVINAIKSAVQTAWNFMKNSVITPVMNGIKTVITTVWNAIKTAVQTVVNAIKTTVQTVFNAVKTTVTTIWNAIKTGTSTAWNAVKTAVTTPINAAKSAVTSAINGIKSTISSVWNSVKSATSSTWNAIKRA-----------ITTPINAAKTAVGNAISAIRSKFNFSWS</Hsp_hseq>
476              <Hsp_midline>V   WE IK+ +  A+  +V  V   +  +   +    E  R T  +VW  I++ V+T            VM A+   + T W+ I    TTV+N IK+ V T    +   ++  VM  I+   S  W T+K    T+   IKS VQ A + +   +    +  +K++  TVW  I   V  + + IKTTV     AV   +  I  +I+T   T WNA+ T  +    A  + V S +  I   I +    +K+  S+ W  IK             +T   +  K A+ NA   I++K +  W+</Hsp_midline>
477            </Hsp>
478          </Hit_hsps>
479        </Hit>
480        <Hit>
481          <Hit_num>7</Hit_num>
482          <Hit_id>gi|262113750|emb|CAR95417.1|</Hit_id>
483          <Hit_def>hypothetical protein [Streptococcus phage phi-m46.1]</Hit_def>
484          <Hit_accession>CAR95417</Hit_accession>
485          <Hit_len>952</Hit_len>
486          <Hit_hsps>
487            <Hsp>
488              <Hsp_num>1</Hsp_num>
489              <Hsp_bit-score>218.779196490092</Hsp_bit-score>
490              <Hsp_score>556</Hsp_score>
491              <Hsp_evalue>1.80201837527491e-54</Hsp_evalue>
492              <Hsp_query-from>384</Hsp_query-from>
493              <Hsp_query-to>1241</Hsp_query-to>
494              <Hsp_hit-from>540</Hsp_hit-from>
495              <Hsp_hit-to>818</Hsp_hit-to>
496              <Hsp_query-frame>3</Hsp_query-frame>
497              <Hsp_hit-frame>0</Hsp_hit-frame>
498              <Hsp_identity>110</Hsp_identity>
499              <Hsp_positive>166</Hsp_positive>
500              <Hsp_gaps>7</Hsp_gaps>
501              <Hsp_align-len>286</Hsp_align-len>
502              <Hsp_qseq>FAKLVGIIAGISAPIWXXXXXXXXXXXXXXXXYNTNEEFRTKVQAAWEAIKSAISTAVEAVVSFVMDLWGQMVAWWNENQELIRQTAETVWNAIR…

Large files files are truncated, but you can click here to view the full file