PageRenderTime 16ms CodeModel.GetById 13ms app.highlight 0ms RepoModel.GetById 1ms app.codeStats 0ms

/test-data/emboss_getorf_out.fasta

https://bitbucket.org/cistrome/cistrome-harvard/
Unknown | 65 lines | 65 code | 0 blank | 0 comment | 0 complexity | 232dddcf600ec477bd98141e1e282a5f MD5 | raw file
 1>Sequence_1 [1 - 51] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
 2VRCLKYLLLSLHRPQFS
 3>Sequence_2 [14 - 94] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
 4NTFFCPYTDHSFPNGFTPTRNSCASTN
 5>Sequence_3 [94 - 129] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
 6LKAVGLECYRFV
 7>Sequence_4 [133 - 231] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
 8LSASLALIKGSFSLLWKTLWKNTTSTSLSPLVC
 9>Sequence_5 [155 - 250] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
10SKVHFLYFGRRCGRIQQVRVSPPWFADYWIQL
11>Sequence_6 [3 - 272] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
12SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAERVSCPDQRFIFSTLE
13DVVEEYNKYESLPPGLLITGYSCNTLRNTA
14>Sequence_7 [235 - 309] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
15LLDTVVIPFATPRNYLYELFSLYYM
16>Sequence_8 [288 - 335] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
17IIFPLLYVVGSSLIFL
18>Sequence_9 [339 - 377] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
19QVFYCFRPQCSCS
20>Sequence_10 [254 - 391] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
21YPSQHRVTIYMNYFPFIICSRFVFNLPLASLLLFSTSMFMFLGCFG
22>Sequence_11 [395 - 427] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
23YAVSLIFVVSS
24>Sequence_12 [328 - 447] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
25SSFSKSFTVFDLNVHVLRLFWIICGQFNLRCFFLKYLFMV
26>Sequence_13 [411 - 521] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
27SSLFLLKIFIHGLIFGLYLFRGQFIIYSVCIQQFFYF
28>Sequence_14 [431 - 526] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
29NIYSWFNFWFVLVQGPVHYLLCLYTAVLLFLV
30>Sequence_15 [451 - 537] 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
31FLVCTCSGASSLFTLFVYSSSFIFSMILI
32>Sequence_16 [531 - 487] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
33NHTKNKRTAVYKQSK
34>Sequence_17 [536 - 450] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
35IKIILKIKELLYTNRVNNELAPEQVQTKN
36>Sequence_18 [487 - 443] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
37IMNWPLNKYKPKIKP
38>Sequence_19 [468 - 439] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
39TSTNQKLNHE
40>Sequence_20 [439 - 410] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
41INILRRNNED
42>Sequence_21 [446 - 405] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
43TMNKYFKKKQRRLN
44>Sequence_22 [401 - 372] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
45PHIIQNNLRT
46>Sequence_23 [368 - 327] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
47TLRSKTVKDLLKED
48>Sequence_24 [426 - 292] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
49EETTKIKLTAYYPKQPKNMNIEVENSKRLAKGRLKTNLLHIIKGK
50>Sequence_25 [279 - 238] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
51IVTRCCEGYYNCIQ
52>Sequence_26 [234 - 175] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
53SANQGGETRTCCILPQRLPK
54>Sequence_27 [334 - 158] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
55RKIKDEPTTYNKGKIIHIDSYAVLRRVLQLYPVISKPGGRDSYLLYSSTTSSKVEKMNL
56>Sequence_28 [275 - 120] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
57LRGVAKGITTVSSNQQTRGERLVLVVFFHNVFQSRENEPLIRARDALSYTNR
58>Sequence_29 [162 - 112] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
59TFDQGKRRAQLYKPVTL
60>Sequence_30 [108 - 34] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
61ANRFQLVLAQEFLVGVKPLGKLWSV
62>Sequence_31 [50 - 3] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
63ENCGLCRDKRRYFRHR
64>Sequence_32 [154 - 2] (REVERSE SENSE) 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
65SGQETRSAIQTGNTLGQPLSISACTRISSRCKAIRKTVVCVGTKEGILGIE