PageRenderTime 39ms CodeModel.GetById 17ms app.highlight 11ms RepoModel.GetById 2ms app.codeStats 0ms

/test-data/tblastn_four_human_vs_rhodopsin.html

https://bitbucket.org/cistrome/cistrome-harvard/
HTML | 787 lines | 455 code | 332 blank | 0 comment | 0 complexity | ff88f5cfe603d27892e5a9a8157d090d MD5 | raw file
  1<HTML>
  2<TITLE>BLAST Search Results</TITLE>
  3<BODY BGCOLOR="#FFFFFF" LINK="#0000FF" VLINK="#660099" ALINK="#660099">
  4<PRE>
  5
  6<b>TBLASTN 2.2.25+</b>
  7
  8
  9<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
 10OS=Homo sapiens GN=ERP44 PE=1 SV=1
 11
 12Length=406
 13
 14<b>Subject=</b> gi|57163782|ref|NM_001009242.1| Felis catus rhodopsin (RHO), mRNA
 15
 16Length=1047
 17
 18
 19***** No hits found *****
 20
 21
 22
 23Lambda     K      H
 24   0.347    0.182    0.684 
 25
 26Gapped
 27Lambda     K      H
 28   0.299   0.0710    0.270 
 29
 30Effective search space used: 127710
 31
 32
 33<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
 34OS=Homo sapiens GN=ERP44 PE=1 SV=1
 35
 36Length=406
 37
 38<b>Subject=</b> gi|2734705|gb|U59921.1|BBU59921 Bufo bufo rhodopsin mRNA, complete
 39cds
 40
 41Length=1574
 42
 43
 44***** No hits found *****
 45
 46
 47
 48Lambda     K      H
 49   0.347    0.182    0.684 
 50
 51Gapped
 52Lambda     K      H
 53   0.299   0.0710    0.270 
 54
 55Effective search space used: 127710
 56
 57
 58<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
 59OS=Homo sapiens GN=ERP44 PE=1 SV=1
 60
 61Length=406
 62
 63<b>Subject=</b> gi|283855845|gb|GQ290303.1| Cynopterus brachyotis voucher 20020434
 64rhodopsin (RHO) gene, exons 1 through 5 and partial cds
 65
 66Length=4301
 67
 68
 69***** No hits found *****
 70
 71
 72
 73Lambda     K      H
 74   0.347    0.182    0.684 
 75
 76Gapped
 77Lambda     K      H
 78   0.299   0.0710    0.270 
 79
 80Effective search space used: 127710
 81
 82
 83<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
 84OS=Homo sapiens GN=ERP44 PE=1 SV=1
 85
 86Length=406
 87
 88<b>Subject=</b> gi|283855822|gb|GQ290312.1| Myotis ricketti voucher GQX10 rhodopsin
 89(RHO) mRNA, partial cds
 90
 91Length=983
 92
 93
 94***** No hits found *****
 95
 96
 97
 98Lambda     K      H
 99   0.347    0.182    0.684 
100
101Gapped
102Lambda     K      H
103   0.299   0.0710    0.270 
104
105Effective search space used: 127710
106
107
108<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
109OS=Homo sapiens GN=ERP44 PE=1 SV=1
110
111Length=406
112
113<b>Subject=</b> gi|18148870|dbj|AB062417.1| Synthetic construct Bos taurus gene for
114rhodopsin, complete cds
115
116Length=1047
117
118
119***** No hits found *****
120
121
122
123Lambda     K      H
124   0.347    0.182    0.684 
125
126Gapped
127Lambda     K      H
128   0.299   0.0710    0.270 
129
130Effective search space used: 127710
131
132
133<b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
134OS=Homo sapiens GN=ERP44 PE=1 SV=1
135
136Length=406
137
138<b>Subject=</b> gi|12583664|dbj|AB043817.1| Conger myriaster conf gene for fresh
139water form rod opsin, complete cds
140
141Length=1344
142
143
144***** No hits found *****
145
146
147
148Lambda     K      H
149   0.347    0.182    0.684 
150
151Gapped
152Lambda     K      H
153   0.299   0.0710    0.270 
154
155Effective search space used: 127710
156
157
158<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
159GN=BMP2K PE=1 SV=2
160
161Length=1161
162
163<b>Subject=</b> gi|57163782|ref|NM_001009242.1| Felis catus rhodopsin (RHO), mRNA
164
165Length=1047
166
167
168***** No hits found *****
169
170
171
172Lambda     K      H
173   0.334    0.170    0.615 
174
175Gapped
176Lambda     K      H
177   0.299   0.0710    0.270 
178
179Effective search space used: 370988
180
181
182<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
183GN=BMP2K PE=1 SV=2
184
185Length=1161
186
187<b>Subject=</b> gi|2734705|gb|U59921.1|BBU59921 Bufo bufo rhodopsin mRNA, complete
188cds
189
190Length=1574
191
192
193***** No hits found *****
194
195
196
197Lambda     K      H
198   0.334    0.170    0.615 
199
200Gapped
201Lambda     K      H
202   0.299   0.0710    0.270 
203
204Effective search space used: 370988
205
206
207<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
208GN=BMP2K PE=1 SV=2
209
210Length=1161
211
212<b>Subject=</b> gi|283855845|gb|GQ290303.1| Cynopterus brachyotis voucher 20020434
213rhodopsin (RHO) gene, exons 1 through 5 and partial cds
214
215Length=4301
216
217
218***** No hits found *****
219
220
221
222Lambda     K      H
223   0.334    0.170    0.615 
224
225Gapped
226Lambda     K      H
227   0.299   0.0710    0.270 
228
229Effective search space used: 370988
230
231
232<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
233GN=BMP2K PE=1 SV=2
234
235Length=1161
236
237<b>Subject=</b> gi|283855822|gb|GQ290312.1| Myotis ricketti voucher GQX10 rhodopsin
238(RHO) mRNA, partial cds
239
240Length=983
241
242
243***** No hits found *****
244
245
246
247Lambda     K      H
248   0.334    0.170    0.615 
249
250Gapped
251Lambda     K      H
252   0.299   0.0710    0.270 
253
254Effective search space used: 370988
255
256
257<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
258GN=BMP2K PE=1 SV=2
259
260Length=1161
261
262<b>Subject=</b> gi|18148870|dbj|AB062417.1| Synthetic construct Bos taurus gene for
263rhodopsin, complete cds
264
265Length=1047
266
267
268***** No hits found *****
269
270
271
272Lambda     K      H
273   0.334    0.170    0.615 
274
275Gapped
276Lambda     K      H
277   0.299   0.0710    0.270 
278
279Effective search space used: 370988
280
281
282<b>Query=</b> sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens
283GN=BMP2K PE=1 SV=2
284
285Length=1161
286
287<b>Subject=</b> gi|12583664|dbj|AB043817.1| Conger myriaster conf gene for fresh
288water form rod opsin, complete cds
289
290Length=1344
291
292
293***** No hits found *****
294
295
296
297Lambda     K      H
298   0.334    0.170    0.615 
299
300Gapped
301Lambda     K      H
302   0.299   0.0710    0.270 
303
304Effective search space used: 370988
305
306
307<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
308SV=4
309
310Length=1382
311
312<b>Subject=</b> gi|57163782|ref|NM_001009242.1| Felis catus rhodopsin (RHO), mRNA
313
314Length=1047
315
316
317***** No hits found *****
318
319
320
321Lambda     K      H
322   0.346    0.180    0.700 
323
324Gapped
325Lambda     K      H
326   0.299   0.0710    0.270 
327
328Effective search space used: 441350
329
330
331<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
332SV=4
333
334Length=1382
335
336<b>Subject=</b> gi|2734705|gb|U59921.1|BBU59921 Bufo bufo rhodopsin mRNA, complete
337cds
338
339Length=1574
340
341
342***** No hits found *****
343
344
345
346Lambda     K      H
347   0.346    0.180    0.700 
348
349Gapped
350Lambda     K      H
351   0.299   0.0710    0.270 
352
353Effective search space used: 441350
354
355
356<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
357SV=4
358
359Length=1382
360
361<b>Subject=</b> gi|283855845|gb|GQ290303.1| Cynopterus brachyotis voucher 20020434
362rhodopsin (RHO) gene, exons 1 through 5 and partial cds
363
364Length=4301
365
366
367***** No hits found *****
368
369
370
371Lambda     K      H
372   0.346    0.180    0.700 
373
374Gapped
375Lambda     K      H
376   0.299   0.0710    0.270 
377
378Effective search space used: 441350
379
380
381<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
382SV=4
383
384Length=1382
385
386<b>Subject=</b> gi|283855822|gb|GQ290312.1| Myotis ricketti voucher GQX10 rhodopsin
387(RHO) mRNA, partial cds
388
389Length=983
390
391
392***** No hits found *****
393
394
395
396Lambda     K      H
397   0.346    0.180    0.700 
398
399Gapped
400Lambda     K      H
401   0.299   0.0710    0.270 
402
403Effective search space used: 441350
404
405
406<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
407SV=4
408
409Length=1382
410
411<b>Subject=</b> gi|18148870|dbj|AB062417.1| Synthetic construct Bos taurus gene for
412rhodopsin, complete cds
413
414Length=1047
415
416
417***** No hits found *****
418
419
420
421Lambda     K      H
422   0.346    0.180    0.700 
423
424Gapped
425Lambda     K      H
426   0.299   0.0710    0.270 
427
428Effective search space used: 441350
429
430
431<b>Query=</b> sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1
432SV=4
433
434Length=1382
435
436<b>Subject=</b> gi|12583664|dbj|AB043817.1| Conger myriaster conf gene for fresh
437water form rod opsin, complete cds
438
439Length=1344
440
441
442***** No hits found *****
443
444
445
446Lambda     K      H
447   0.346    0.180    0.700 
448
449Gapped
450Lambda     K      H
451   0.299   0.0710    0.270 
452
453Effective search space used: 441350
454
455
456<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
457
458Length=348
459
460<b>Subject=</b> gi|57163782|ref|NM_001009242.1| Felis catus rhodopsin (RHO), mRNA
461
462Length=1047
463
464<script src="blastResult.js"></script>
465 Score =  732 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
466 Identities = 336/348 (97%), Positives = 343/348 (99%), Gaps = 0/348 (0%)
467 Frame = +1
468
469Query  1     MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY  60
470             MNGTEGPNFYVPFSN TGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY
471Sbjct  1     MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY  180
472
473Query  61    VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLG  120
474             VTVQHKKLRTPLNYILLNLAVADLFMV GGFT+TLYTSLHGYFVFGPTGCNLEGFFATLG
475Sbjct  181   VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG  360
476
477Query  121   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP  180
478             GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPL GWSRYIP
479Sbjct  361   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP  540
480
481Query  181   EGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES  240
482             EG+QCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMI+IFFCYGQLVFTVKEAAAQQQES
483Sbjct  541   EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES  720
484
485Query  241   ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI  300
486             ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMT+PAFFAKS++I
487Sbjct  721   ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI  900
488
489Query  301   YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA  348
490             YNPVIYIMMNKQFRNCMLTT+CCGKNPLGDDEAS T SKTETSQVAPA
491Sbjct  901   YNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTGSKTETSQVAPA  1044
492
493
494
495Lambda     K      H
496   0.351    0.182    0.707 
497
498Gapped
499Lambda     K      H
500   0.299   0.0710    0.270 
501
502Effective search space used: 109230
503
504
505<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
506
507Length=348
508
509<b>Subject=</b> gi|2734705|gb|U59921.1|BBU59921 Bufo bufo rhodopsin mRNA, complete
510cds
511
512Length=1574
513
514<script src="blastResult.js"></script>
515 Score =  646 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
516 Identities = 290/342 (85%), Positives = 320/342 (94%), Gaps = 1/342 (0%)
517 Frame = +3
518
519Query  1     MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY  60
520             MNGTEGPNFY+P SN TGVVRSPFEYPQYYLAEPWQ+S+L AYMFLLI+LGFPINF+TLY
521Sbjct  42    MNGTEGPNFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSILCAYMFLLILLGFPINFMTLY  221
522
523Query  61    VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLG  120
524             VT+QHKKLRTPLNYILLNLA A+ FMVL GFT T+Y+S+ GYF+ G TGC +EGFFATLG
525Sbjct  222   VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTVTMYSSMNGYFILGATGCYVEGFFATLG  401
526
527Query  121   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP  180
528             GEIALWSLVVLAIERYVVVCKPMSNFRF ENHA+MGVAFTW+MAL+CA PPL GWSRYIP
529Sbjct  402   GEIALWSLVVLAIERYVVVCKPMSNFRFSENHAVMGVAFTWIMALSCAVPPLLGWSRYIP  581
530
531Query  181   EGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES  240
532             EG+QCSCG+DYYTLKPEVNNESFVIYMFVVHFTIP+IIIFFCYG+LV TVKEAAAQQQES
533Sbjct  582   EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFTIPLIIIFFCYGRLVCTVKEAAAQQQES  761
534
535Query  241   ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI  300
536             ATTQKAEKEVTRMVIIMV+ FLICWVPYASVAF+IF+ QGS FGPIFMT+PAFFAKS++I
537Sbjct  762   ATTQKAEKEVTRMVIIMVVFFLICWVPYASVAFFIFSNQGSEFGPIFMTVPAFFAKSSSI  941
538
539Query  301   YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEA-SATVSKTE  341
540             YNPVIYIM+NKQFRNCM+TT+CCGKNP G+D+A SA  SKTE
541Sbjct  942   YNPVIYIMLNKQFRNCMITTLCCGKNPFGEDDASSAATSKTE  1067
542
543
544
545Lambda     K      H
546   0.351    0.182    0.707 
547
548Gapped
549Lambda     K      H
550   0.299   0.0710    0.270 
551
552Effective search space used: 109230
553
554
555<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
556
557Length=348
558
559<b>Subject=</b> gi|283855845|gb|GQ290303.1| Cynopterus brachyotis voucher 20020434
560rhodopsin (RHO) gene, exons 1 through 5 and partial cds
561
562Length=4301
563
564<script src="blastResult.js"></script>
565 Score =  151 bits (342),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
566 Identities = 69/74 (94%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
567 Frame = +3
568
569Query  239   ESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSA  298
570             ESATTQKAEKEVTRMVIIMVIAFLICW+PYA VAFYIFTHQGSNFGPIFMT+PAFFAKS+
571Sbjct  3147  ESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSNFGPIFMTLPAFFAKSS  3326
572
573Query  299   AIYNPVIYIMMNKQ  312
574             +IYNPVIYIMMNKQ
575Sbjct  3327  SIYNPVIYIMMNKQ  3368
576
577
578 Score =  126 bits (284),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
579 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
580 Frame = +2
581
582Query  177   RYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAA  235
583             RYIPEG+QCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMI+IFFCYGQLVFTVKE  +
584Sbjct  2855  RYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEVRS  3031
585
586
587 Score =  229 bits (523),  Expect = 1e-64, Method: Compositional matrix adjust.
588 Identities = 107/111 (97%), Positives = 109/111 (99%), Gaps = 0/111 (0%)
589 Frame = +1
590
591Query  11   VPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT  70
592            VPFSN TGVVRSPFE+PQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT
593Sbjct  1    VPFSNKTGVVRSPFEHPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT  180
594
595Query  71   PLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGG  121
596            PLNYILLNLAVADLFMV GGFT+TLYTSLHGYFVFGPTGCNLEGFFATLGG
597Sbjct  181  PLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGG  333
598
599
600 Score =  122 bits (276),  Expect = 1e-32, Method: Compositional matrix adjust.
601 Identities = 55/59 (94%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
602 Frame = +3
603
604Query  119   LGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSR  177
605             L GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMG+A TWVMALACAAPPL GWSR
606Sbjct  1404  LAGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWVMALACAAPPLVGWSR  1580
607
608
609 Score = 57.7 bits (125),  Expect = 6e-13, Method: Compositional matrix adjust.
610 Identities = 23/26 (89%), Positives = 24/26 (93%), Gaps = 0/26 (0%)
611 Frame = +1
612
613Query  312   QFRNCMLTTICCGKNPLGDDEASATV  337
614             QFRNCMLTT+CCGKNPLGDDEAS T 
615Sbjct  4222  QFRNCMLTTLCCGKNPLGDDEASTTA  4299
616
617
618
619Lambda     K      H
620   0.351    0.182    0.707 
621
622Gapped
623Lambda     K      H
624   0.299   0.0710    0.270 
625
626Effective search space used: 109230
627
628
629<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
630
631Length=348
632
633<b>Subject=</b> gi|283855822|gb|GQ290312.1| Myotis ricketti voucher GQX10 rhodopsin
634(RHO) mRNA, partial cds
635
636Length=983
637
638<script src="blastResult.js"></script>
639 Score =  658 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
640 Identities = 310/326 (96%), Positives = 322/326 (99%), Gaps = 0/326 (0%)
641 Frame = +1
642
643Query  11   VPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT  70
644            VPFSN TGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT
645Sbjct  1    VPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT  180
646
647Query  71   PLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVV  130
648            PLNYILLNLAVA+LFMV GGFT+TLYTS+HGYFVFG TGCNLEGFFATLGGEIALWSLVV
649Sbjct  181  PLNYILLNLAVANLFMVFGGFTTTLYTSMHGYFVFGATGCNLEGFFATLGGEIALWSLVV  360
650
651Query  131  LAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGID  190
652            LAIERYVVVCKPMSNFRFGENHAIMG+AFTWVMALACAAPPLAGWSRYIPEG+QCSCGID
653Sbjct  361  LAIERYVVVCKPMSNFRFGENHAIMGLAFTWVMALACAAPPLAGWSRYIPEGMQCSCGID  540
654
655Query  191  YYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV  250
656            YYTLKPEVNNESFVIYMFVVHFTIPMI+IFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
657Sbjct  541  YYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV  720
658
659Query  251  TRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMN  310
660            TRMVIIMV+AFLICW+PYASVAFYIFTHQGSNFGP+FMTIPAFFAKS++IYNPVIYIMMN
661Sbjct  721  TRMVIIMVVAFLICWLPYASVAFYIFTHQGSNFGPVFMTIPAFFAKSSSIYNPVIYIMMN  900
662
663Query  311  KQFRNCMLTTICCGKNPLGDDEASAT  336
664            KQFRNCMLTT+CCGKNPLGDDEAS T
665Sbjct  901  KQFRNCMLTTLCCGKNPLGDDEASTT  978
666
667
668
669Lambda     K      H
670   0.351    0.182    0.707 
671
672Gapped
673Lambda     K      H
674   0.299   0.0710    0.270 
675
676Effective search space used: 109230
677
678
679<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
680
681Length=348
682
683<b>Subject=</b> gi|18148870|dbj|AB062417.1| Synthetic construct Bos taurus gene for
684rhodopsin, complete cds
685
686Length=1047
687
688<script src="blastResult.js"></script>
689 Score =  711 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
690 Identities = 325/348 (94%), Positives = 337/348 (97%), Gaps = 0/348 (0%)
691 Frame = +1
692
693Query  1     MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY  60
694             MNGTEGPNFYVPFSN TGVVRSPFE PQYYLAEPWQFSMLAAYMFLLI+LGFPINFLTLY
695Sbjct  1     MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY  180
696
697Query  61    VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLG  120
698             VTVQHKKLRTPLNYILLNLAVADLFMV GGFT+TLYTSLHGYFVFGPTGCNLEGFFATLG
699Sbjct  181   VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG  360
700
701Query  121   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP  180
702             GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPL GWSRYIP
703Sbjct  361   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP  540
704
705Query  181   EGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES  240
706             EG+QCSCGIDYYT   E NNESFVIYMFVVHF IP+I+IFFCYGQLVFTVKEAAAQQQES
707Sbjct  541   EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES  720
708
709Query  241   ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI  300
710             ATTQKAEKEVTRMVIIMVIAFLICW+PYA VAFYIFTHQGS+FGPIFMTIPAFFAK++A+
711Sbjct  721   ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV  900
712
713Query  301   YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA  348
714             YNPVIYIMMNKQFRNCM+TT+CCGKNPLGDDEAS TVSKTETSQVAPA
715Sbjct  901   YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA  1044
716
717
718
719Lambda     K      H
720   0.351    0.182    0.707 
721
722Gapped
723Lambda     K      H
724   0.299   0.0710    0.270 
725
726Effective search space used: 109230
727
728
729<b>Query=</b> sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1
730
731Length=348
732
733<b>Subject=</b> gi|12583664|dbj|AB043817.1| Conger myriaster conf gene for fresh
734water form rod opsin, complete cds
735
736Length=1344
737
738<script src="blastResult.js"></script>
739 Score =  626 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
740 Identities = 281/342 (83%), Positives = 311/342 (91%), Gaps = 1/342 (0%)
741 Frame = +2
742
743Query  1     MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY  60
744             MNGTEGPNFY+P SNATGVVRSPFEYPQYYLAEPW FS L+AYMF LI+ GFPINFLTLY
745Sbjct  23    MNGTEGPNFYIPMSNATGVVRSPFEYPQYYLAEPWAFSALSAYMFFLIIAGFPINFLTLY  202
746
747Query  61    VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLG  120
748             VT++HKKLRTPLNYILLNLAVADLFMV GGFT+T+YTS+HGYFVFGPTGCN+EGFFATLG
749Sbjct  203   VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVFGPTGCNIEGFFATLG  382
750
751Query  121   GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP  180
752             GEIALW LVVLAIER++VVCKP++NFRFGE HAIMGV  TW MALACA PPL GWSRYIP
753Sbjct  383   GEIALWCLVVLAIERWMVVCKPVTNFRFGESHAIMGVMVTWTMALACALPPLFGWSRYIP  562
754
755Query  181   EGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES  240
756             EGLQCSCGIDYYT  P +NNESFVIYMF  HF+IP+ +I FCYG+LV TVKEAAAQQQES
757Sbjct  563   EGLQCSCGIDYYTRAPGINNESFVIYMFTCHFSIPLAVISFCYGRLVCTVKEAAAQQQES  742
758
759Query  241   ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI  300
760              TTQ+AE+EVTRMV+IMVI+FL+CWVPYASVA YIFTHQGS FGPIFMTIP+FFAKS+A+
761Sbjct  743   ETTQRAEREVTRMVVIMVISFLVCWVPYASVAWYIFTHQGSTFGPIFMTIPSFFAKSSAL  922
762
763Query  301   YNPVIYIMMNKQFRNCMLTTICCGKNPL-GDDEASATVSKTE  341
764             YNP+IYI MNKQFR CM+TT+CCGKNP   +D ASAT SKTE
765Sbjct  923   YNPMIYICMNKQFRHCMITTLCCGKNPFEEEDGASATSSKTE  1048
766
767
768
769Lambda     K      H
770   0.351    0.182    0.707 
771
772Gapped
773Lambda     K      H
774   0.299   0.0710    0.270 
775
776Effective search space used: 109230
777
778
779
780
781Matrix: BLOSUM80
782Gap Penalties: Existence: 10, Extension: 1
783Neighboring words threshold: 14
784Window for multiple hits: 25
785</PRE>
786</BODY>
787</HTML>