/Tests/test_Emboss.py
https://bitbucket.org/christophchamp/biopython · Python · 913 lines · 844 code · 21 blank · 48 comment · 69 complexity · 9e9343ba7aaea26df4aaf888fb26ae31 MD5 · raw file
- # Copyright 2009 by Peter Cock. All rights reserved.
- # This code is part of the Biopython distribution and governed by its
- # license. Please see the LICENSE file that should have been included
- # as part of this package.
- """Runs a few EMBOSS tools to check our wrappers and parsers."""
- import os
- import sys
- import unittest
- import subprocess
- from StringIO import StringIO
- from Bio.Emboss.Applications import WaterCommandline, NeedleCommandline
- from Bio.Emboss.Applications import SeqretCommandline, SeqmatchallCommandline
- from Bio import SeqIO
- from Bio import AlignIO
- from Bio import MissingExternalDependencyError
- from Bio.Alphabet import generic_protein, generic_dna, generic_nucleotide
- from Bio.Seq import Seq, translate
- from Bio.SeqRecord import SeqRecord
- #from Bio.Data.IUPACData import ambiguous_dna_letters
- #################################################################
- #Try to avoid problems when the OS is in another language
- os.environ['LANG'] = 'C'
- exes_wanted = ["water", "needle", "seqret", "transeq", "seqmatchall",
- "embossversion"]
- exes = dict() #Dictionary mapping from names to exe locations
- if "EMBOSS_ROOT" in os.environ:
- #Windows default installation path is C:\mEMBOSS which contains the exes.
- #EMBOSS also sets an environment variable which we will check for.
- path = os.environ["EMBOSS_ROOT"]
- if os.path.isdir(path):
- for name in exes_wanted:
- if os.path.isfile(os.path.join(path, name+".exe")):
- exes[name] = os.path.join(path, name+".exe")
- del path, name
- if sys.platform!="win32":
- import commands
- for name in exes_wanted:
- #This will "just work" if installed on the path as normal on Unix
- output = commands.getoutput("%s -help" % name)
- if "not found" not in output and "not recognized" not in output:
- exes[name] = name
- del output
- del name
- if len(exes) < len(exes_wanted):
- raise MissingExternalDependencyError(\
- "Install EMBOSS if you want to use Bio.Emboss.")
- def get_emboss_version():
- """Returns a tuple of three ints, e.g. (6,1,0)"""
- #Windows and Unix versions of EMBOSS seem to differ in
- #which lines go to stdout and stderr - so merge them.
- child = subprocess.Popen(exes["embossversion"],
- stdout=subprocess.PIPE,
- stderr=subprocess.STDOUT,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- stdout, stderr = child.communicate()
- child.stdout.close() #This is both stdout and stderr
- del child
- assert stderr is None #Send to stdout instead
- for line in stdout.split("\n"):
- if line.strip()=="Reports the current EMBOSS version number":
- pass
- elif line.startswith("Writes the current EMBOSS version number"):
- pass
- elif line.count(".")==2:
- return tuple(int(v) for v in line.strip().split("."))
- elif line.count(".")==3:
- #e.g. I installed mEMBOSS-6.2.0.1-setup.exe
- #which reports 6.2.0.1 - for this return (6,2,0)
- return tuple(int(v) for v in line.strip().split("."))[:3]
- else:
- #Either we can't understand the output, or this is really
- #an error message not caught earlier (e.g. not in English)
- raise MissingExternalDependencyError(\
- "Install EMBOSS if you want to use Bio.Emboss (%s)." \
- % line)
-
- #To avoid confusing known errors from old versions of EMBOSS ...
- emboss_version = get_emboss_version()
- if emboss_version < (6,1,0):
- raise MissingExternalDependencyError(\
- "Test requires EMBOSS 6.1.0 patch 3 or later.")
-
- #################################################################
- #Top level function as this makes it easier to use for debugging:
- def emboss_convert(filename, old_format, new_format):
- """Run seqret, returns handle."""
- #Setup, this assumes for all the format names used
- #Biopython and EMBOSS names are consistent!
- cline = SeqretCommandline(exes["seqret"],
- sequence = filename,
- sformat = old_format,
- osformat = new_format,
- auto = True, #no prompting
- stdout = True)
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- child.stdin.close()
- child.stderr.close()
- return child.stdout
- #Top level function as this makes it easier to use for debugging:
- def emboss_piped_SeqIO_convert(records, old_format, new_format):
- """Run seqret, returns records (as a generator)."""
- #Setup, this assumes for all the format names used
- #Biopython and EMBOSS names are consistent!
- cline = SeqretCommandline(exes["seqret"],
- sformat = old_format,
- osformat = new_format,
- auto = True, #no prompting
- filter = True)
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- SeqIO.write(records, child.stdin, old_format)
- child.stdin.close()
- child.stderr.close()
- #TODO - Is there a nice way to return an interator AND
- #automatically close the handle?
- records = list(SeqIO.parse(child.stdout, new_format))
- child.stdout.close()
- return records
- #Top level function as this makes it easier to use for debugging:
- def emboss_piped_AlignIO_convert(alignments, old_format, new_format):
- """Run seqret, returns alignments (as a generator)."""
- #Setup, this assumes for all the format names used
- #Biopython and EMBOSS names are consistent!
- cline = SeqretCommandline(exes["seqret"],
- sformat = old_format,
- osformat = new_format,
- auto = True, #no prompting
- filter = True)
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- try:
- AlignIO.write(alignments, child.stdin, old_format)
- except Exception, err:
- child.stdin.close()
- child.stderr.close()
- child.stdout.close()
- raise
- child.stdin.close()
- child.stderr.close()
- #TODO - Is there a nice way to return an interator AND
- #automatically close the handle?
- try:
- aligns = list(AlignIO.parse(child.stdout, new_format))
- except Exception, err:
- child.stdout.close()
- raise
- child.stdout.close()
- return aligns
- #Top level function as this makes it easier to use for debugging:
- def compare_records(old_list, new_list):
- """Check two lists of SeqRecords agree, raises a ValueError if mismatch."""
- if len(old_list) != len(new_list):
- raise ValueError("%i vs %i records" % (len(old_list), len(new_list)))
- for old, new in zip(old_list, new_list):
- #Note the name matching is a bit fuzzy, e.g. truncation and
- #no spaces in PHYLIP files.
- if old.id != new.id and old.name != new.name \
- and (old.id not in new.id) and (new.id not in old.id) \
- and (old.id.replace(" ","_") != new.id.replace(" ","_")):
- raise ValueError("'%s' or '%s' vs '%s' or '%s' records" \
- % (old.id, old.name, new.id, new.name))
- if len(old.seq) != len(new.seq):
- raise ValueError("%i vs %i" % (len(old.seq), len(new.seq)))
- if str(old.seq).upper() != str(new.seq).upper():
- if str(old.seq).replace("X","N")==str(new.seq) :
- raise ValueError("X -> N (protein forced into nucleotide?)")
- if len(old.seq) < 200:
- raise ValueError("'%s' vs '%s'" % (old.seq, new.seq))
- else:
- raise ValueError("'%s...%s' vs '%s...%s'" \
- % (old.seq[:60], old.seq[-10:],
- new.seq[:60], new.seq[-10:]))
- if old.features and new.features \
- and len(old.features) != len(new.features):
- raise ValueError("%i vs %i features" \
- % (len(old.features, len(new.features))))
- #TODO - check annotation
- return True
- #Top level function as this makes it easier to use for debugging:
- def compare_alignments(old_list, new_list):
- """Check two lists of Alignments agree, raises a ValueError if mismatch."""
- if len(old_list) != len(new_list):
- raise ValueError("%i vs %i alignments" % (len(old_list), len(new_list)))
- for old, new in zip(old_list, new_list):
- if len(old) != len(new):
- raise ValueError("Alignment with %i vs %i records" \
- % (len(old), len(new)))
- compare_records(old,new)
- return True
- class SeqRetSeqIOTests(unittest.TestCase):
- """Check EMBOSS seqret against Bio.SeqIO for converting files."""
- def tearDown(self):
- clean_up()
- def check_SeqIO_to_EMBOSS(self, in_filename, in_format, skip_formats=[],
- alphabet=None):
- """Can Bio.SeqIO write files seqret can read back?"""
- if alphabet:
- records = list(SeqIO.parse(in_filename, in_format, alphabet))
- else:
- records = list(SeqIO.parse(in_filename, in_format))
- for temp_format in ["genbank","embl","fasta"]:
- if temp_format in skip_formats:
- continue
- new_records = list(emboss_piped_SeqIO_convert(records, temp_format, "fasta"))
- try:
- self.assertTrue(compare_records(records, new_records))
- except ValueError, err:
- raise ValueError("Disagree on file %s %s in %s format: %s" \
- % (in_format, in_filename, temp_format, err))
-
- def check_EMBOSS_to_SeqIO(self, filename, old_format,
- skip_formats=[]):
- """Can Bio.SeqIO read seqret's conversion of the file?"""
- #TODO: Why can't we read EMBOSS's swiss output?
- self.assertTrue(os.path.isfile(filename))
- old_records = list(SeqIO.parse(filename, old_format))
- for new_format in ["genbank","fasta","pir","embl", "ig"]:
- if new_format in skip_formats:
- continue
- handle = emboss_convert(filename, old_format, new_format)
- new_records = list(SeqIO.parse(handle, new_format))
- handle.close()
- try:
- self.assertTrue(compare_records(old_records, new_records))
- except ValueError, err:
- raise ValueError("Disagree on %s file %s in %s format: %s" \
- % (old_format, filename, new_format, err))
- def check_SeqIO_with_EMBOSS(self, filename, old_format, skip_formats=[],
- alphabet=None):
- #Check EMBOSS can read Bio.SeqIO output...
- self.check_SeqIO_to_EMBOSS(filename, old_format, skip_formats,
- alphabet)
- #Check Bio.SeqIO can read EMBOSS seqret output...
- self.check_EMBOSS_to_SeqIO(filename, old_format, skip_formats)
- def test_abi(self):
- """SeqIO agrees with EMBOSS' Abi to FASTQ conversion."""
- #This lets use check the id, sequence, and quality scores
- for filename in ["Abi/3730.ab1", "Abi/empty.ab1"]:
- old = SeqIO.read(filename, "abi")
- handle = emboss_convert(filename, "abi", "fastq-sanger")
- new = SeqIO.read(handle, "fastq-sanger")
- handle.close()
- if emboss_version == (6,4,0) and new.id == "EMBOSS_001":
- #Avoid bug in EMBOSS 6.4.0 (patch forthcoming)
- pass
- else:
- self.assertEqual(old.id, new.id)
- self.assertEqual(str(old.seq), str(new.seq))
- if emboss_version < (6,3,0) and new.letter_annotations["phred_quality"] == [1]*len(old):
- #Apparent bug in EMBOSS 6.2.0.1 on Windows
- pass
- else:
- self.assertEqual(old.letter_annotations, new.letter_annotations)
- def test_genbank(self):
- """SeqIO & EMBOSS reading each other's conversions of a GenBank file."""
- self.check_SeqIO_with_EMBOSS("GenBank/cor6_6.gb", "genbank")
- def test_genbank2(self):
- """SeqIO & EMBOSS reading each other's conversions of another GenBank file."""
- self.check_SeqIO_with_EMBOSS("GenBank/NC_000932.gb", "genbank")
- def test_embl(self):
- """SeqIO & EMBOSS reading each other's conversions of an EMBL file."""
- self.check_SeqIO_with_EMBOSS("EMBL/U87107.embl", "embl")
- def test_ig(self):
- """SeqIO & EMBOSS reading each other's conversions of an ig file."""
- #NOTE - EMBOSS considers "genbank" to be for nucleotides only,
- #and will turn "X" into "N" for GenBank output.
- self.check_SeqIO_to_EMBOSS("IntelliGenetics/VIF_mase-pro.txt", "ig",
- alphabet=generic_protein,
- skip_formats=["genbank","embl"])
- #TODO - What does a % in an ig sequence mean?
- #e.g. "IntelliGenetics/vpu_nucaligned.txt"
- #and "IntelliGenetics/TAT_mase_nuc.txt"
- #EMBOSS seems to ignore them.
- def test_pir(self):
- """SeqIO & EMBOSS reading each other's conversions of a PIR file."""
- #Skip genbank here, EMBOSS mangles the LOCUS line:
- self.check_SeqIO_with_EMBOSS("NBRF/clustalw.pir", "pir",
- skip_formats=["genbank"])
- #Skip EMBL here, EMBOSS mangles the ID line
- #Skip GenBank, EMBOSS 6.0.1 on Windows won't output proteins as GenBank
- self.check_SeqIO_with_EMBOSS("NBRF/DMB_prot.pir", "pir",
- skip_formats=["embl","genbank"])
- def test_clustalw(self):
- """SeqIO & EMBOSS reading each other's conversions of a Clustalw file."""
- self.check_SeqIO_with_EMBOSS("Clustalw/hedgehog.aln", "clustal",
- skip_formats=["embl","genbank"])
- self.check_SeqIO_with_EMBOSS("Clustalw/opuntia.aln", "clustal",
- skip_formats=["embl","genbank"])
- class SeqRetAlignIOTests(unittest.TestCase):
- """Check EMBOSS seqret against Bio.SeqIO for converting files."""
- def tearDown(self):
- clean_up()
- def check_EMBOSS_to_AlignIO(self, filename, old_format,
- skip_formats=[]):
- """Can AlignIO read seqret's conversion of the file?"""
- self.assertTrue(os.path.isfile(filename), filename)
- old_aligns = list(AlignIO.parse(filename, old_format))
- formats = ["clustal", "phylip", "ig"]
- if len(old_aligns) == 1:
- formats.extend(["fasta","nexus"])
- for new_format in formats:
- if new_format in skip_formats:
- continue
- handle = emboss_convert(filename, old_format, new_format)
- try:
- new_aligns = list(AlignIO.parse(handle, new_format))
- except:
- handle.close()
- raise ValueError("Can't parse %s file %s in %s format." \
- % (old_format, filename, new_format))
- handle.close()
- try:
- self.assertTrue(compare_alignments(old_aligns, new_aligns))
- except ValueError, err:
- raise ValueError("Disagree on %s file %s in %s format: %s" \
- % (old_format, filename, new_format, err))
- def check_AlignIO_to_EMBOSS(self, in_filename, in_format, skip_formats=[],
- alphabet=None):
- """Can Bio.AlignIO write files seqret can read back?"""
- if alphabet:
- old_aligns = list(AlignIO.parse(in_filename,in_format,alphabet))
- else:
- old_aligns = list(AlignIO.parse(in_filename,in_format))
- formats = ["clustal", "phylip"]
- if len(old_aligns) == 1:
- formats.extend(["fasta","nexus"])
- for temp_format in formats:
- if temp_format in skip_formats:
- continue
- #PHYLIP is a simple format which explicitly supports
- #multiple alignments (unlike FASTA).
- try:
- new_aligns = list(emboss_piped_AlignIO_convert(old_aligns,
- temp_format,
- "phylip"))
- except ValueError, e:
- #e.g. ValueError: Need a DNA, RNA or Protein alphabet
- #from writing Nexus files...
- continue
- try:
- self.assertTrue(compare_alignments(old_aligns, new_aligns))
- except ValueError, err:
- raise ValueError("Disagree on file %s %s in %s format: %s" \
- % (in_format, in_filename, temp_format, err))
- def check_AlignIO_with_EMBOSS(self, filename, old_format, skip_formats=[],
- alphabet=None):
- #Check EMBOSS can read Bio.AlignIO output...
- self.check_AlignIO_to_EMBOSS(filename, old_format, skip_formats,
- alphabet)
- #Check Bio.AlignIO can read EMBOSS seqret output...
- self.check_EMBOSS_to_AlignIO(filename, old_format, skip_formats)
-
- def test_align_clustalw(self):
- """AlignIO & EMBOSS reading each other's conversions of a ClustalW file."""
- self.check_AlignIO_with_EMBOSS("Clustalw/hedgehog.aln", "clustal")
- self.check_AlignIO_with_EMBOSS("Clustalw/opuntia.aln", "clustal")
- self.check_AlignIO_with_EMBOSS("Clustalw/odd_consensus.aln", "clustal",
- skip_formats=["nexus"]) #TODO - why not nexus?
- self.check_AlignIO_with_EMBOSS("Clustalw/protein.aln", "clustal")
- self.check_AlignIO_with_EMBOSS("Clustalw/promals3d.aln", "clustal")
- def test_clustalw(self):
- """AlignIO & EMBOSS reading each other's conversions of a PHYLIP file."""
- self.check_AlignIO_with_EMBOSS("Phylip/horses.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/hennigian.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/reference_dna.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/reference_dna2.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/interlaced.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/interlaced2.phy", "phylip")
- self.check_AlignIO_with_EMBOSS("Phylip/random.phy", "phylip")
-
- class PairwiseAlignmentTests(unittest.TestCase):
- """Run pairwise alignments with water and needle, and parse them."""
- def tearDown(self):
- clean_up()
-
- def pairwise_alignment_check(self, query_seq,
- targets, alignments,
- local=True):
- """Check pairwise alignment data is sane."""
- #The datasets should be small, so making iterators into lists is OK
- targets = list(targets)
- alignments = list(alignments)
- self.assertEqual(len(targets), len(alignments))
- for target, alignment in zip(targets, alignments):
- self.assertEqual(len(alignment), 2)
- #self.assertEqual(target.id, alignment[1].id) #too strict
- if alignment[1].id not in target.id \
- and alignment[1].id not in target.name:
- raise AssertionError("%s vs %s or %s" \
- % (alignment[1].id , target.id, target.name))
- if local:
- #Local alignment
- self.assertTrue(str(alignment[0].seq).replace("-","") \
- in query_seq)
- self.assertTrue(str(alignment[1].seq).replace("-","").upper() \
- in str(target.seq).upper())
- else:
- #Global alignment
- self.assertEqual(str(query_seq), str(alignment[0].seq).replace("-",""))
- self.assertEqual(str(target.seq).upper(), \
- str(alignment[1].seq).replace("-","").upper())
- return True
- def run_water(self, cline):
- #Run the tool,
- stdout, stderr = cline()
- self.assertTrue(stderr.strip().startswith("Smith-Waterman local alignment"),
- stderr)
- if cline.outfile:
- self.assertEqual(stdout.strip(), "")
- self.assertTrue(os.path.isfile(cline.outfile),
- "Missing output file %r from:\n%s" % (cline.outfile, cline))
- else :
- #Don't use this yet... could return stdout handle instead?
- return stdout
- def test_water_file(self):
- """water with the asis trick, output to a file."""
- #Setup, try a mixture of keyword arguments and later additions:
- cline = WaterCommandline(cmd=exes["water"],
- gapopen="10", gapextend="0.5")
- #Try using both human readable names, and the literal ones:
- cline.set_parameter("asequence", "asis:ACCCGGGCGCGGT")
- cline.set_parameter("-bsequence", "asis:ACCCGAGCGCGGT")
- #Try using a property set here:
- cline.outfile = "Emboss/temp with space.water"
- self.assertEqual(str(eval(repr(cline))), str(cline))
- #Run the tool,
- self.run_water(cline)
- #Check we can parse the output...
- align = AlignIO.read(cline.outfile,"emboss")
- self.assertEqual(len(align), 2)
- self.assertEqual(str(align[0].seq), "ACCCGGGCGCGGT")
- self.assertEqual(str(align[1].seq), "ACCCGAGCGCGGT")
- #Clean up,
- os.remove(cline.outfile)
-
- def test_water_piped(self):
- """water with asis trick, output piped to stdout."""
- cline = WaterCommandline(cmd=exes["water"],
- asequence="asis:ACCCGGGCGCGGT",
- bsequence="asis:ACCCGAGCGCGGT",
- gapopen=10,
- gapextend=0.5,
- auto=True, filter=True)
- self.assertEqual(str(cline),
- exes["water"] + " -auto -filter" \
- + " -asequence=asis:ACCCGGGCGCGGT" \
- + " -bsequence=asis:ACCCGAGCGCGGT" \
- + " -gapopen=10 -gapextend=0.5")
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- child.stdin.close()
- #Check we could read it's output
- align = AlignIO.read(child.stdout, "emboss")
- self.assertEqual(len(align), 2)
- self.assertEqual(str(align[0].seq), "ACCCGGGCGCGGT")
- self.assertEqual(str(align[1].seq), "ACCCGAGCGCGGT")
- #Check no error output:
- self.assertEqual(child.stderr.read(), "")
- self.assertEqual(0, child.wait())
- child.stdout.close()
- child.stderr.close()
- def test_needle_file(self):
- """needle with the asis trick, output to a file."""
- #Setup,
- cline = NeedleCommandline(cmd=exes["needle"])
- cline.set_parameter("-asequence", "asis:ACCCGGGCGCGGT")
- cline.set_parameter("-bsequence", "asis:ACCCGAGCGCGGT")
- cline.set_parameter("-gapopen", "10")
- cline.set_parameter("-gapextend", "0.5")
- #EMBOSS would guess this, but let's be explicit:
- cline.set_parameter("-snucleotide", "True")
- cline.set_parameter("-outfile", "Emboss/temp with space.needle")
- self.assertEqual(str(eval(repr(cline))), str(cline))
- #Run the tool,
- stdout, stderr = cline()
- #Check it worked,
- self.assertTrue(stderr.strip().startswith("Needleman-Wunsch global alignment"), stderr)
- self.assertEqual(stdout.strip(), "")
- filename = cline.outfile
- self.assertTrue(os.path.isfile(filename),
- "Missing output file %r from:\n%s" % (filename, cline))
- #Check we can parse the output...
- align = AlignIO.read(filename,"emboss")
- self.assertEqual(len(align), 2)
- self.assertEqual(str(align[0].seq), "ACCCGGGCGCGGT")
- self.assertEqual(str(align[1].seq), "ACCCGAGCGCGGT")
- #Clean up,
- os.remove(filename)
- def test_needle_piped(self):
- """needle with asis trick, output piped to stdout."""
- cline = NeedleCommandline(cmd=exes["needle"],
- asequence="asis:ACCCGGGCGCGGT",
- bsequence="asis:ACCCGAGCGCGGT",
- gapopen=10,
- gapextend=0.5,
- auto=True, filter=True)
- self.assertEqual(str(cline),
- exes["needle"] + " -auto -filter" \
- + " -asequence=asis:ACCCGGGCGCGGT" \
- + " -bsequence=asis:ACCCGAGCGCGGT" \
- + " -gapopen=10 -gapextend=0.5")
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- child.stdin.close()
- #Check we could read it's output
- align = AlignIO.read(child.stdout, "emboss")
- self.assertEqual(len(align), 2)
- self.assertEqual(str(align[0].seq), "ACCCGGGCGCGGT")
- self.assertEqual(str(align[1].seq), "ACCCGAGCGCGGT")
- #Check no error output:
- self.assertEqual(child.stderr.read(), "")
- self.assertEqual(0, child.wait())
- child.stdout.close()
- child.stderr.close()
- def test_water_file2(self):
- """water with the asis trick and nucleotide FASTA file, output to a file."""
- #Setup,
- query = "ACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGNCTCAAAGGCAAGGTGCACGCAGAGGGACGTTTGAGTCTGGGATGAAGCATGTNCGTATTATTTATATGATGGAATTTCACGTTTTTATG"
- out_file = "Emboss/temp_test2.water"
- in_file = "Fasta/f002"
- self.assertTrue(os.path.isfile(in_file))
- if os.path.isfile(out_file):
- os.remove(out_file)
- cline = WaterCommandline(cmd=exes["water"])
- cline.set_parameter("-asequence", "asis:%s" % query)
- cline.set_parameter("-bsequence", in_file)
- cline.set_parameter("-gapopen", "10")
- cline.set_parameter("-gapextend", "0.5")
- cline.set_parameter("-outfile", out_file)
- self.assertEqual(str(eval(repr(cline))), str(cline))
- #Run the tool,
- self.run_water(cline)
- #Check we can parse the output and it is sensible...
- self.pairwise_alignment_check(query,
- SeqIO.parse(in_file,"fasta"),
- AlignIO.parse(out_file,"emboss"),
- local=True)
- #Clean up,
- os.remove(out_file)
- def test_water_file3(self):
- """water with the asis trick and GenBank file, output to a file."""
- #Setup,
- query = "TGTTGTAATGTTTTAATGTTTCTTCTCCCTTTAGATGTACTACGTTTGGA"
- out_file = "Emboss/temp_test3.water"
- in_file = "GenBank/cor6_6.gb"
- self.assertTrue(os.path.isfile(in_file))
- if os.path.isfile(out_file):
- os.remove(out_file)
- cline = WaterCommandline(cmd=exes["water"])
- cline.set_parameter("asequence", "asis:%s" % query)
- cline.set_parameter("bsequence", in_file)
- #TODO - Tell water this is a GenBank file!
- cline.set_parameter("gapopen", "1")
- cline.set_parameter("gapextend", "0.5")
- cline.set_parameter("outfile", out_file)
- self.assertEqual(str(eval(repr(cline))), str(cline))
- #Run the tool,
- self.run_water(cline)
- #Check we can parse the output and it is sensible...
- self.pairwise_alignment_check(query,
- SeqIO.parse(in_file,"genbank"),
- AlignIO.parse(out_file,"emboss"),
- local=True)
- #Clean up,
- os.remove(out_file)
- def test_water_file4(self):
- """water with the asis trick and SwissProt file, output to a file."""
- #Setup,
- query = "DVCTGKALCDPVTQNIKTYPVKIENLRVMI"
- out_file = "Emboss/temp_test4.water"
- in_file = "SwissProt/sp004"
- self.assertTrue(os.path.isfile(in_file))
- if os.path.isfile(out_file):
- os.remove(out_file)
- cline = WaterCommandline(cmd=exes["water"])
- cline.set_parameter("-asequence", "asis:%s" % query)
- cline.set_parameter("-bsequence", in_file)
- #EMBOSS should work this out, but let's be explicit:
- cline.set_parameter("-sprotein", True)
- #TODO - Tell water this is a SwissProt file!
- cline.set_parameter("-gapopen", "20")
- cline.set_parameter("-gapextend", "5")
- cline.set_parameter("-outfile", out_file)
- self.assertEqual(str(eval(repr(cline))), str(cline))
- #Run the tool,
- self.run_water(cline)
- #Check we can parse the output and it is sensible...
- self.pairwise_alignment_check(query,
- SeqIO.parse(in_file,"swiss"),
- AlignIO.parse(out_file,"emboss"),
- local=True)
- #Clean up,
- os.remove(out_file)
-
- def test_needle_piped2(self):
- """needle with asis trick, and nucleotide FASTA file, output piped to stdout."""
- #TODO - Support needle in Bio.Emboss.Applications
- #(ideally with the -auto and -filter arguments)
- #Setup,
- query = "ACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAA"
- cline = exes["needle"]
- cline += " -asequence asis:" + query
- cline += " -bsequence Fasta/f002"
- cline += " -auto" #no prompting
- cline += " -filter" #use stdout
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- child.stdin.close()
- #Check we can parse the output and it is sensible...
- self.pairwise_alignment_check(query,
- SeqIO.parse("Fasta/f002","fasta"),
- AlignIO.parse(child.stdout,"emboss"),
- local=False)
- #Check no error output:
- self.assertEqual(child.stderr.read(), "")
- self.assertEqual(0, child.wait())
- child.stdout.close()
- child.stderr.close()
- def test_water_needs_output(self):
- """water without output file or stdout/filter should give error."""
- cline = WaterCommandline(cmd=exes["water"],
- asequence="asis:ACCCGGGCGCGGT",
- bsequence="asis:ACCCGAGCGCGGT",
- gapopen=10,
- gapextend=0.5,
- auto=True)
- self.assertTrue(cline.auto)
- self.assertTrue(not cline.stdout)
- self.assertTrue(not cline.filter)
- self.assertEqual(cline.outfile, None)
- self.assertRaises(ValueError, str, cline)
- def test_needle_needs_output(self):
- """needle without output file or stdout/filter should give error."""
- cline = NeedleCommandline(cmd=exes["needle"],
- asequence="asis:ACCCGGGCGCGGT",
- bsequence="asis:ACCCGAGCGCGGT",
- gapopen=10,
- gapextend=0.5,
- auto=True)
- self.assertTrue(cline.auto)
- self.assertTrue(not cline.stdout)
- self.assertTrue(not cline.filter)
- self.assertEqual(cline.outfile, None)
- self.assertRaises(ValueError, str, cline)
-
- def test_seqtmatchall_piped(self):
- """seqmatchall with pair output piped to stdout."""
- cline = SeqmatchallCommandline(cmd=exes["seqmatchall"],
- sequence="Fasta/f002",
- aformat="pair", wordsize=9,
- auto=True, stdout=True)
- self.assertEqual(str(cline),
- exes["seqmatchall"] + " -auto -stdout" \
- + " -sequence=Fasta/f002"
- + " -wordsize=9 -aformat=pair")
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- child.stdin.close()
- #Check we could read it's output
- for align in AlignIO.parse(child.stdout, "emboss") :
- self.assertEqual(len(align), 2)
- self.assertEqual(align.get_alignment_length(), 9)
- #Check no error output:
- self.assertEqual(child.stderr.read(), "")
- self.assertEqual(0, child.wait())
- child.stdout.close()
- child.stderr.close()
-
- #Top level function as this makes it easier to use for debugging:
- def emboss_translate(sequence, table=None, frame=None):
- """Call transeq, returns protein sequence as string."""
- #TODO - Support transeq in Bio.Emboss.Applications?
- #(doesn't seem worthwhile as Biopython can do translations)
- if not sequence:
- raise ValueError(sequence)
- #Setup,
- cline = exes["transeq"]
- if len(sequence) < 100:
- filename = None
- cline += " -sequence asis:%s" % sequence
- else:
- #There are limits on command line string lengths...
- #use a temp file instead.
- filename = "Emboss/temp_transeq.txt"
- SeqIO.write(SeqRecord(sequence, id="Test"), filename, "fasta")
- cline += " -sequence %s" % filename
- cline += " -auto" #no prompting
- cline += " -filter" #use stdout
- if table is not None:
- cline += " -table %s" % str(table)
- if frame is not None:
- cline += " -frame %s" % str(frame)
- #Run the tool,
- child = subprocess.Popen(str(cline),
- stdin=subprocess.PIPE,
- stdout=subprocess.PIPE,
- stderr=subprocess.PIPE,
- universal_newlines=True,
- shell=(sys.platform!="win32"))
- out, err = child.communicate()
- #Check no error output:
- if err != "":
- raise ValueError(str(cline) + "\n" + err)
- #Check we could read it's output
- record = SeqIO.read(StringIO(out), "fasta")
- if 0 != child.wait():
- raise ValueError(str(cline))
-
- if filename:
- os.remove(filename)
- if not record.id.startswith("Test"):
- raise ValueError(str(cline))
- else:
- if not record.id.startswith("asis"):
- raise ValueError(str(cline))
- return str(record.seq)
- #Top level function as this makes it easier to use for debugging:
- def check_translation(sequence, translation, table=None):
- if table is None:
- t = 1
- else:
- t = table
- if translation != str(sequence.translate(t)) \
- or translation != str(translate(sequence,t)) \
- or translation != translate(str(sequence),t):
- #More details...
- for i, amino in enumerate(translation):
- codon = sequence[i*3:i*3+3]
- if amino != str(codon.translate(t)):
- raise ValueError("%s -> %s not %s (table %s)" \
- % (codon, amino, codon.translate(t), t))
- #Shouldn't reach this line:
- raise ValueError("%s -> %s (table %s)" \
- % (sequence, translation, t))
- return True
- class TranslationTests(unittest.TestCase):
- """Run pairwise alignments with water and needle, and parse them."""
- def tearDown(self):
- clean_up()
- def test_simple(self):
- """transeq vs Bio.Seq for simple translations (including alt tables)."""
- examples = [Seq("ACGTGACTGACGTAGCATGCCACTAGG"),
- #Unamibguous TA? codons:
- Seq("TAATACTATTAG", generic_dna),
- #Most of the ambiguous TA? codons:
- Seq("TANTARTAYTAMTAKTAHTABTADTAV", generic_dna),
- #Problem cases,
- #
- #Seq("TAW", generic_dna),
- #W = A or T, but EMBOSS does TAW -> X
- #TAA -> Y, TAT ->Y, so in Biopython TAW -> Y
- #
- #Seq("TAS", generic_dna),
- #S = C or G, but EMBOSS does TAS -> Y
- #TAG -> *, TAC ->Y, so in Biopython TAS -> X (Y or *)
- #
- #Seq("AAS", generic_dna),
- #On table 9, EMBOSS gives N, we give X.
- #S = C or G, so according to my reading of
- #table 9 on the NCBI page, AAC=N, AAG=K
- #suggesting this is a bug in EMBOSS.
- #
- Seq("ACGGGGGGGGTAAGTGGTGTGTGTGTAGT", generic_dna),
- ]
-
- for sequence in examples:
- #EMBOSS treats spare residues differently... avoid this issue
- if len(sequence) % 3 != 0:
- sequence = sequence[:-(len(sequence)%3)]
- self.assertEqual(len(sequence) % 3, 0)
- self.assertTrue(len(sequence) > 0)
- self.check(sequence)
- def check(self, sequence):
- """Compare our translation to EMBOSS's using all tables.
- Takes a Seq object (and a filename containing it)."""
- translation = emboss_translate(sequence)
- self.assertTrue(check_translation(sequence, translation))
- for table in [1,2,3,4,5,6,9,10,11,12,13,14,15,16,21,22,23]:
- translation = emboss_translate(sequence, table)
- self.assertTrue(check_translation(sequence, translation, table))
- return True
- def translate_all_codons(self, letters):
- sequence = Seq("".join([c1+c3+c3 \
- for c1 in letters \
- for c2 in letters \
- for c3 in letters]),
- generic_nucleotide)
- self.check(sequence)
-
- #def test_all_ambig_dna_codons(self):
- # """transeq vs Bio.Seq on ambiguous DNA codons (inc. alt tables)."""
- # self.translate_all_codons(ambiguous_dna_letters)
- def test_all_unambig_dna_codons(self):
- """transeq vs Bio.Seq on unambiguous DNA codons (inc. alt tables)."""
- self.translate_all_codons("ATCGatcg")
- def test_all_unambig_rna_codons(self):
- """transeq vs Bio.Seq on unambiguous RNA codons (inc. alt tables)."""
- self.translate_all_codons("AUCGaucg")
- def test_mixed_unambig_rna_codons(self):
- """transeq vs Bio.Seq on unambiguous DNA/RNA codons (inc. alt tables)."""
- self.translate_all_codons("ATUCGatucg")
-
- def clean_up():
- """Fallback clean up method to remove temp files."""
- for filename in os.listdir("Emboss"):
- if filename.startswith("temp_"):
- try:
- os.remove(filename)
- except:
- pass
- if __name__ == "__main__":
- runner = unittest.TextTestRunner(verbosity = 2)
- unittest.main(testRunner=runner)
- clean_up()