/test/unit/bio/appl/hmmer/test_report.rb
https://github.com/nmb/bioruby · Ruby · 343 lines · 260 code · 73 blank · 10 comment · 0 complexity · f183654213c75c4a80b9f1748f90b20e MD5 · raw file
- #
- # test/unit/bio/appl/hmmer/test_report.rb - Unit test for Bio::HMMER::Report
- #
- # Copyright:: Copyright (C) 2006 Mitsuteru Nakao <n@bioruby.org>
- # License:: The Ruby License
- #
- # $Id:$
- #
- # loading helper routine for testing bioruby
- require 'pathname'
- load Pathname.new(File.join(File.dirname(__FILE__), ['..'] * 4,
- 'bioruby_test_helper.rb')).cleanpath.to_s
- # libraries needed for the tests
- require 'test/unit'
- require 'bio/appl/hmmer/report'
- module Bio
- class TestHMMERReportData
- TestDataHMMER = Pathname.new(File.join(BioRubyTestDataPath, 'HMMER')).cleanpath.to_s
- def self.hmmpfam
- File.open(File.join(TestDataHMMER, 'hmmpfam.out')).read
- end
- def self.output
- self.hmmpfam
- end
- def self.hmmsearch
- File.open(File.join(TestDataHMMER, 'hmmsearch.out')).read
- end
- end
- class TestHMMERReportClassMethods < Test::Unit::TestCase
- def test_reports_ary
- ary = Bio::HMMER.reports(Bio::TestHMMERReportData.output)
- assert_equal(Array, ary.class)
- end
- def test_reports_ary_contents
- Bio::HMMER.reports(Bio::TestHMMERReportData.output).each do |report|
- assert_equal(Bio::HMMER::Report, report.class)
- end
- end
- end
-
- class TestHMMERReportConstants < Test::Unit::TestCase
- def test_rs
- assert_equal("\n//\n", Bio::HMMER::Report::RS)
- assert_equal("\n//\n", Bio::HMMER::Report::DELIMITER)
- end
- end
-
- class TestHMMERReportHmmpfam < Test::Unit::TestCase
- def setup
- @obj = Bio::HMMER::Report.new(Bio::TestHMMERReportData.hmmpfam)
- end
-
- def test_program
- assert_equal(Hash, @obj.program.class)
- assert_equal("hmmpfam - search one or more sequences against HMM database", @obj.program['name'])
- assert_equal("HMMER 2.3.2 (Oct 2003)", @obj.program['version'])
- assert_equal("Copyright (C) 1992-2003 HHMI/Washington University School of Medicine", @obj.program['copyright'])
- assert_equal("Freely distributed under the GNU General Public License (GPL)", @obj.program['license'])
- end
- def test_parameter
- assert_equal(Hash, @obj.parameter.class)
- assert_equal("/Users/nakao/Sites/iprscan/tmp/20050517/iprscan-20050517-16244071/chunk_1/iprscan-20050517-16244071.nocrc", @obj.parameter["Sequence file"])
- assert_equal("/Users/nakao/Sites/iprscan/data/Pfam", @obj.parameter['HMM file'])
- end
- def test_query_info
- assert_equal(Hash, @obj.query_info.class)
- assert_equal("104K_THEPA", @obj.query_info["Query sequence"])
- assert_equal("[none]", @obj.query_info["Accession"])
- assert_equal("[none]", @obj.query_info["Description"])
- end
- def test_hits
- assert_equal(Bio::HMMER::Report::Hit, @obj.hits.first.class)
- end
- def test_hsps
- assert_equal(Bio::HMMER::Report::Hsp, @obj.hsps.first.class)
- end
- def test_histogram
- assert_equal(nil, @obj.histogram)
- end
- def test_statistical_detail
- assert_equal(nil, @obj.statistical_detail)
- end
- def test_total_seq_searched
- assert_equal(nil, @obj.total_seq_searched)
- end
- def test_whole_seq_top_hits
- assert_equal(nil, @obj.whole_seq_top_hits)
- end
- def test_domain_top_hits
- assert_equal(nil, @obj.domain_top_hits)
- end
- def test_each
- @obj.each do |hit|
- assert_equal(Bio::HMMER::Report::Hit, hit.class)
- end
- end
- def test_each_hit
- @obj.each_hit do |hit|
- assert_equal(Bio::HMMER::Report::Hit, hit.class)
- end
- end
- end
- class TestHMMERReportHit < Test::Unit::TestCase
- def setup
- @obj = Bio::HMMER::Report.new(Bio::TestHMMERReportData.output).hits.first
- end
- def test_hit
- assert_equal(Bio::HMMER::Report::Hit, @obj.class)
- end
- def test_hsps
- assert_equal(Bio::HMMER::Report::Hsp, @obj.hsps.first.class)
- end
- def test_accession
- assert_equal("PF04385.4", @obj.accession)
- end
- def test_target_id
- assert_equal("PF04385.4", @obj.target_id)
- end
- def test_hit_id
- assert_equal("PF04385.4", @obj.hit_id)
- end
- def test_entry_id
- assert_equal("PF04385.4", @obj.entry_id)
- end
- def test_description
- assert_equal("Domain of unknown function, DUF529", @obj.description)
- end
- def test_definition
- assert_equal("Domain of unknown function, DUF529", @obj.definition)
- end
- def test_score
- assert_equal(259.3, @obj.score)
- end
- def test_bit_score
- assert_equal(259.3, @obj.bit_score)
- end
- def test_evalue
- assert_equal(6.6e-75, @obj.evalue)
- end
- def test_num
- assert_equal(4, @obj.num)
- end
-
- def test_each
- @obj.each do |hsp|
- assert_equal(Bio::HMMER::Report::Hsp, hsp.class)
- end
- end
- def test_each_hsp
- @obj.each_hsp do |hsp|
- assert_equal(Bio::HMMER::Report::Hsp, hsp.class)
- end
- end
- def test_target_def
- assert_equal("<4> Domain of unknown function, DUF529", @obj.target_def)
- end
- def test_append_hsp
- hsp = @obj.hsps.first
- assert_equal(5, @obj.append_hsp(hsp).size)
- end
- end
- class TestHMMERReportHsp < Test::Unit::TestCase
- def setup
- @obj = Bio::HMMER::Report.new(Bio::TestHMMERReportData.output).hits.first.hsps.first
- end
- def test_hsp
- assert_equal(Bio::HMMER::Report::Hsp, @obj.class)
- end
-
- def test_accession
- assert_equal("PF04385.4", @obj.accession)
- end
- def test_domain
- assert_equal("1/4", @obj.domain)
- end
- def test_seq_f
- assert_equal(36, @obj.seq_f)
- end
- def test_seq_t
- assert_equal(111, @obj.seq_t)
- end
- def test_seq_ft
- assert_equal("..", @obj.seq_ft)
- end
- def test_hmm_f
- assert_equal(1, @obj.hmm_f)
- end
- def test_hmm_t
- assert_equal(80, @obj.hmm_t)
- end
- def test_score
- assert_equal(65.0, @obj.score)
- end
- def test_bit_score
- assert_equal(65.0, @obj.bit_score)
- end
- def test_evalue
- assert_equal(2.0e-16, @obj.evalue)
- end
- def test_midline
- assert_equal("t+D+n++++ f +v+++g+++ + ++ ++v+++++++Gn+v+We++ + +l++ ++++++++++++++++ +++", @obj.midline)
- end
- def test_hmmseq
- assert_equal("tLDlndtgstlkqfdykvalngdivvtytpkpGvkftkitdGnevvWeseddpefglivtlsfyldsnkfLvlllintak", @obj.hmmseq)
- end
- def test_flatseq
- assert_equal("TFDINSNQTG-PAFLTAVEMAGVKYLQVQHGSNVNIHRLVEGNVVIWENA---STPLYTGAIVTNNDGPYMAYVEVLGDP", @obj.flatseq)
- end
- def test_query_frame
- assert_equal(1, @obj.query_frame)
- end
- def test_target_frame
- assert_equal(1, @obj.target_frame)
- end
- def test_csline
- assert_equal(nil, @obj.csline)
- end
- def test_rfline
- assert_equal(nil, @obj.rfline)
- end
- def test_set_alignment
- end
- def test_query_seq
- assert_equal("TFDINSNQTG-PAFLTAVEMAGVKYLQVQHGSNVNIHRLVEGNVVIWENA---STPLYTGAIVTNNDGPYMAYVEVLGDP", @obj.query_seq)
- end
- def test_target_seq
- assert_equal("tLDlndtgstlkqfdykvalngdivvtytpkpGvkftkitdGnevvWeseddpefglivtlsfyldsnkfLvlllintak", @obj.target_seq)
- end
- def test_target_from
- assert_equal(1, @obj.target_from)
- end
- def test_targat_to
- assert_equal(80, @obj.target_to)
- end
- def test_query_from
- assert_equal(36, @obj.query_from)
- end
- def test_query_to
- assert_equal(111, @obj.query_to)
- end
- end
- class TestHMMERReportHmmsearch < Test::Unit::TestCase
- def setup
- @obj = Bio::HMMER::Report.new(Bio::TestHMMERReportData.hmmsearch)
- end
- def test_histogram
- hist = "score obs exp (one = represents 1 sequences)\n----- --- ---\n 377 1 0|="
- assert_equal(hist, @obj.histogram)
- end
-
- def test_statistical_detail
- hash = {"P(chi-square)" => 0.0, "chi-sq statistic" => 0.0, "lambda" => 0.7676, "mu" => -10.6639}
- assert_equal(hash, @obj.statistical_detail)
- hash.keys.each do |key|
- assert_equal(hash[key], @obj.statistical_detail[key])
- end
- end
-
- def test_total_seq_searched
- assert_equal(1, @obj.total_seq_searched)
- end
- def test_whole_seq_top_hit
- hash = {"Total memory" => "16K", "Satisfying E cutoff" => 1, "Total hits" => 1}
- assert_equal(hash, @obj.whole_seq_top_hits)
- hash.keys.each do |key|
- assert_equal(hash[key], @obj.whole_seq_top_hits[key])
- end
- end
- def test_domain_top_hits
- hash = {"Total memory" => "17K", "Satisfying E cutoff" => 1, "Total hits" => 1}
- assert_equal(hash, @obj.domain_top_hits)
- hash.keys.each do |key|
- assert_equal(hash[key], @obj.domain_top_hits[key])
- end
- end
- end
- end # module Bio