PageRenderTime 209ms CodeModel.GetById 195ms app.highlight 4ms RepoModel.GetById 1ms app.codeStats 1ms

/examples/data/ensembl_pax.fasta

http://github.com/sbotond/phylosim
Unknown | 8464 lines | 8464 code | 0 blank | 0 comment | 0 complexity | 19115dabad5ca713ecfa17b5df20b68d MD5 | raw file

Large files files are truncated, but you can click here to view the full file

  1>ENSOGAP00000011965
  2F-------SCP-------------------------------------------------
  3------------------------------------------------------------
  4------------------------------------------------------------
  5------------------------------------------------------------
  6------------------------------------------------------------
  7------------------------------------------------------------
  8------------------------------------------------------------
  9------------------------------------------------------------
 10-GISSMNQLGGLFVNGRPL--------------PLDTRQQIVQLAVS-GMRPCDISRSLK
 11------------------VSNGCVSKILG--------RYYRTGVLEPKGI------GGSK
 12PR-LATPPVVARIAQLKGECPALFAWEI----------------------QHQLRAEGVC
 13------------------------------------------------------------
 14------------------------------------------------------------
 15TQDKTPS------------------------VSSINRVLRTLQ-----------------
 16------------------------------------------------------------
 17------------------------------------------------------------
 18------------------------------------------------------------
 19------------------------------------------------------------
 20------------------------------------------------------------
 21--------------------------------------------------EDQGLPWAQ-
 22-LRSPAVLALAPPNPQSGSEAPRGP-------PGTGHRNRTIFSPGQA------------
 23--------------EALEKE-FQRGQYPDSVVRGKL------AAATSLPEDTV-RVWFSN
 24RRAKWRR-------QEKLKWEMQLP-----------------------------------
 25------------------------------------------------------------
 26------------------------------------------------------------
 27------------------------------GATQGLTVPKFSSGIISAQ---QAPGSVPT
 28AALPA-------------------------------------------------------
 29------------------------------------------------------------
 30-----------------------------------------------------LELLDPS
 31CCQLCWAIAPDRFLSDTPPQVGLKPCWGYFSPQ-------LSSQDSALLYCPRPS-----
 32TSFGAPQALFRPGSLLLDLG----------------------------------------
 33------------------------------------------------------------
 34------------------------------------------------------------
 35----------------------------------
 36>ENSOPRP00000001544
 37-------------------MQN--------------------------------------
 38------------------------------------------------------------
 39------------------------------------------------------------
 40------------------------------------------------------------
 41------------------------------------------------------------
 42------------------------------------------------------------
 43------------------------------------------------------------
 44------------------------------------------------------------
 45-SHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
 46----THADAKVQVLDNQNVSNGCVSKILG--------RYYETGSIRPRAI------GGSK
 47PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
 48------------------------------------------------------------
 49------------------------------------------------------------
 50TNDNIPS------------------------VSSINRVLRNLA-----------------
 51------------------------------------------------------------
 52------------------------------------------------------------
 53------------------------------------------------------------
 54------------------------------------------------------------
 55--------------------------------------------------------SEKQ
 56Q------MGADGMYDKLRMLNGQTGS-----WGTRPGWYPGTSVPGQPTQ--DGCQPQE-
 57-GAGENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
 58--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
 59RRAKWRR-------EEKLRNQRRQASNTPSHIPISS------------------------
 60------------------------------------------------------------
 61-SFSTSVYQPIPQPTTPV-SSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPV
 62---TNQTSS---YSNMLPPSPSVN------GRSYDTYTPPHMQTHMNSQPMGTSGTTSTG
 63LISPGVSVPVQVPGSEPDMSQYWPRLQ---------------------------------
 64------------------------------------------------------------
 65------------------------------------------------------------
 66------------------------------------------------------------
 67------------------------------------------------------------
 68------------------------------------------------------------
 69------------------------------------------------------------
 70----------------------------------
 71>ENSRNOP00000006302
 72-------------------MQN--------------------------------------
 73------------------------------------------------------------
 74------------------------------------------------------------
 75------------------------------------------------------------
 76------------------------------------------------------------
 77------------------------------------------------------------
 78------------------------------------------------------------
 79------------------------------------------------------------
 80-SHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
 81----THADAKVQVLDSENVSNGCVSKILG--------RYYETGSIRPRAI------GGSK
 82PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
 83------------------------------------------------------------
 84------------------------------------------------------------
 85TNDNIPS------------------------VSSINRVLRNLA-----------------
 86------------------------------------------------------------
 87------------------------------------------------------------
 88------------------------------------------------------------
 89------------------------------------------------------------
 90--------------------------------------------------------SEKQ
 91Q------MGADGMYDKLRMLNGQTGS-----WGTRPGWYPGTSVPGQPTQ--DGCQQQE-
 92-GQGENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
 93--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
 94RRAKWRR-------EEKLRNQRRQASNTPSHIPISS------------------------
 95------------------------------------------------------------
 96-SFSTSVYQPIPQPTTPV-SSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPV
 97---PSQTSS---YSCMLPTSPSVN------GRSYDTYTPPHMQTHMNSQPMGTSGTTSTG
 98LISPGVSVPVQVPGSEPDMSQYWPRLQ---------------------------------
 99------------------------------------------------------------
100------------------------------------------------------------
101------------------------------------------------------------
102------------------------------------------------------------
103------------------------------------------------------------
104------------------------------------------------------------
105----------------------------------
106>ENSP00000350844
107MDLEKNYPTPRTSRT---------------------------------------------
108------------------------------------------------------------
109------------------------------------------------------------
110------------------------------------------------------------
111------------------------------------------------------------
112------------------------------------------------------------
113------------------------------------------------------------
114------------------------------------------------------------
115-GHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
116------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
117PK-VATPKVVEKIAEYKRQNPTMFAWEI----------------------RDRLLAERVC
118------------------------------------------------------------
119------------------------------------------------------------
120DNDTVPS------------------------VSSINRIIRTKV-----------------
121----------------------QQP-----------------------------------
122------------------------------------------------------------
123---------------------------------------------------PNQPVPASS
124--HSIVSTGSVTQVS----------------SVS-------------TDSAGSS--YSIS
125GILGI----TSPSADTN-------------KRKRDEGI----------------------
126--QESPV----------------------------PNGHSLPGRD---------------
127-------------------------F------LRKQMRGDLF-TQQQL------------
128--------------EVLDRV-FERQHYSDIFTTTE-------PIKPEQ--TTE-YSAM--
129ASLAG-G-------LDDMKANLASP-TPADIG----------------------------
130-------------------------------------------------------SSVP-
131-GPQSYP--------------IVT------------------------------------
132---------------------------------------------------GRDLASTT-
133--LPG--------------------------------------------------YPPHV
134PP----------------------------------------------------------
135--------------------------------------------------------AGQG
136S----YSAPT-----L-----------TGMVP----------------------------
137------------------GS---------------------------------EFSGSPY
138SHP------QYSSYND-SWRFPNP------------GLL-------------------GS
139PYYYSAA-----------------------------ARGAAP----PAAAT--AYDRH--
140----------------------------------
141>ENSDARP00000043209
142----------------------MDIHCKADP---FSAM----H-----------------
143------------------------------------------------------------
144------------------------------------------------------------
145------------------------------------------------------------
146------------------------------------------------------------
147------------------------------------------------------------
148------------------------------------------------------------
149------------------------------------------------------------
150-RHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
151------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
152PK-VATPKVVDKIADYKRQNPTMFAWEI----------------------RDRLLAEGIC
153------------------------------------------------------------
154------------------------------------------------------------
155DNDTVPS------------------------VSSINRIIRTKV-----------------
156----------------------QQPFH---------------------------------
157------------------------------------------------------------
158---------------------------------------------PSPDG---TSLSTPG
159--HTIIPSTASPPVS----------------SSS-------------NDPVGS---YSIN
160GILGI------PRSNGE-------------KRKRDADG----------------------
161--SEGSA----------------------------QSSDSQGSVE---------------
162-------------------------S------LRKHLRADAF-TQQQL------------
163--------------EALDRV-FERPVFPDVFPTSE-------HIKPEQ--ASE-YS-L--
164PALNT-G-------LDEVKPSLSSS-AASDLG----------------------------
165-------------------------------------------------------ASVS-
166---QSYP--------------V--------------------------------------
167---------------------------------------------------GRDMANTT-
168--LPG--------------------------------------------------YPPHV
169PP----------------------------------------------------------
170--------------------------------------------------------TGQG
171S----YATST-----L-----------AGMVP----------------------------
172------------------GS---------------------------------EFSGNPY
173SHP------QYTTYNE-AWRFSNP------------AIL-------------------SS
174PYYYSA------------------------------SRGSAP----PTAAT--AYDRH--
175----------------------------------
176>ENSMMUP00000020235
177L-------SRP-------------------------------------------------
178------------------------------------------------------------
179------------------------------------------------------------
180------------------------------------------------------------
181------------------------------------------------------------
182------------------------------------------------------------
183------------------------------------------------------------
184------------------------------------------------------------
185-GISSMNQLGGLFVNGRPL--------------PLDTRQQIVRLAVR-GMRPCDISRSLK
186------------------VSNGCVSKILG--------RYYRTGVLEPKGI------GGSK
187PR-LATPPVVARIAQLKGECPALFAWEI----------------------QRQLCAEGLC
188------------------------------------------------------------
189------------------------------------------------------------
190TQDKTPS------------------------VSSINRVLRALQ-----------------
191------------------------------------------------------------
192------------------------------------------------------------
193------------------------------------------------------------
194------------------------------------------------------------
195------------------------------------------------------------
196--------------------------------------------------EDQGLPWTQ-
197-LRSPAVLAPALLTPHSGSETPRGPH------PGTGHRNRTIFSPSQA------------
198--------------EALEKE-FQRGQYPDSVARGKL------AAATSLPEDTV-RVWFSN
199RRAKWRR-------QEKLKWEMQLP-----------------------------------
200------------------------------------------------------------
201------------------------------------------------------------
202------------------------------GASQGLTVPRVAPGIISAQ---QSPGSVPT
203AVLPA-------------------------------------------------------
204------------------------------------------------------------
205-----------------------------------------------------LEPLGLL
206CLP-CPPTVP------WPVLVAVRPCSG------------------LAAHYYCGSFLFPV
207IAPSCVDLAWPCLDAFLAYYLIGGAGEATPTHFSHWP-----------------------
208------------------------------------------------------------
209------------------------------------------------------------
210----------------------------------
211>ENSMICP00000000087
212F-------SCP-------------------------------------------------
213------------------------------------------------------------
214------------------------------------------------------------
215------------------------------------------------------------
216------------------------------------------------------------
217------------------------------------------------------------
218------------------------------------------------------------
219------------------------------------------------------------
220-GISSVNQLGGLFVNGRPL--------------PLDTRQQIVQLAVR-GMRPCDISRSLK
221------------------VSNGCVSKILG--------RYYRTGVLEPKGI------GGSK
222PR-LATPPVVARIAQLKGECPALFAWEI----------------------QRQLCAEGLC
223------------------------------------------------------------
224------------------------------------------------------------
225TQDKTPS------------------------VSSINRVLRALQ-----------------
226------------------------------------------------------------
227------------------------------------------------------------
228------------------------------------------------------------
229------------------------------------------------------------
230------------------------------------------------------------
231--------------------------------------------------EDQGLSWAQ-
232-LRSPAVLAPAPPTRQSGFEAPRGPH------PGTGHRNRTIFSPGQA------------
233--------------EALEKE-FQRGQYPDSVARGKL------AAATSLPEDTV-RVWFSN
234RRAKWRR-------QEKLKWEMQLP-----------------------------------
235------------------------------------------------------------
236------------------------------------------------------------
237------------------------------GAPQGLTVQKVSPGIVSAQ---QSPGSAPT
238AALPA-------------------------------------------------------
239------------------------------------------------------------
240-----------------------------------------------------LEPLAAP
241CCQLCWATVPDRFLSDAQPQAPLKPCWGYLPPQ-------PSSWDSVLLCCPCPS-----
242SSLGAPQALPPPGSGLLGLGG---------------------------------------
243------------------------------------------------------------
244------------------------------------------------------------
245----------------------------------
246>ENSTNIP00000006290
247LSSIPDLPLFRLLCLA--------------------------------------------
248------------------------------------------------------------
249------------------------------------------------------------
250------------------------------------------------------------
251------------------------------------------------------------
252------------------------------------------------------------
253------------------------------------------------------------
254------------------------------------------------------------
255-GHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
256------------------VSHGCVSKILG--------RYYETGSIRPGVI------GGSK
257PK-VATPKVVDKIADYKRQNPTMFAWEI----------------------RDRLLAERVC
258------------------------------------------------------------
259------------------------------------------------------------
260DNDSVPS------------------------VSSINRIIRTKV-----------------
261----------------------QQQ-----------------------------------
262------------------------------------------------------------
263---------------------------------------------------PGQTGSVSA
264--HNLATSVAATQVS----------------AVT-------------SDSAGSS--YSIS
265GILGI----SSA-ADVG-------------KRKRDEGK----------------------
266--SNSPK----------------------------RSARNARGKD---------------
267-------------------------R------LRVKPCGDLCPQPKQR------------
268--------------EVGCRW-APHPPKYIIYTPKH---------PPPPHQTSD-YSAM--
269ASLTG-G-------LDEMKNSLANPGTGAEIG----------------------------
270-------------------------------------------------------ASVT-
271-GPQSYS--------------LVP------------------------------------
272---------------------------------------------------GRDLASTT-
273--LPG--------------------------------------------------YPPHV
274PP----------------------------------------------------------
275--------------------------------------------------------TGQG
276S----YSTPS-----L-----------TGMVP----------------------------
277------------------GG---------------------------------DFSGSPY
278SHP------QYSTYNE-SWRFPNP------------SLL-------------------GS
279PYYYSAT-----------------------------SRGAGP----AATATASAYDRH--
280----------------------------------
281>ENSSSCP00000014151
282-------------------MQN--------------------------------------
283------------------------------------------------------------
284------------------------------------------------------------
285------------------------------------------------------------
286------------------------------------------------------------
287------------------------------------------------------------
288------------------------------------------------------------
289------------------------------------------------------------
290-SHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
291------------------VSNGCVSKILG--------RYYETGSIRPRAI------GGSK
292PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
293------------------------------------------------------------
294------------------------------------------------------------
295TNDNIPS------------------------VSSINRVLRNLA-----------------
296------------------------------------------------------------
297------------------------------------------------------------
298------------------------------------------------------------
299------------------------------------------------------------
300--------------------------------------------------------SEKQ
301Q------MGADGMYDKLRMLNGQTGS-----WGTRPGWYPGTSVPGQPTQ--DGCQQQE-
302-GGGENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
303--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
304RRAKWRR-------EEKLRNQRRQASNTPSHIPISS------------------------
305------------------------------------------------------------
306-SFSTSVYQPIPQPTTPV-SSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPV
307---PSQTSS---YSCMLPTSPSVN------GRSYDTYTPPHMQTHMNSQPMGTSGTTSTG
308LISPGVSVPVQVPGSEPDMSQYWPRLQ---------------------------------
309------------------------------------------------------------
310------------------------------------------------------------
311------------------------------------------------------------
312------------------------------------------------------------
313------------------------------------------------------------
314------------------------------------------------------------
315----------------------------------
316>ENSPPYP00000003888
317-------------------LSS--------------------------------------
318------------------------------------------------------------
319------------------------------------------------------------
320------------------------------------------------------------
321------------------------------------------------------------
322------------------------------------------------------------
323------------------------------------------------------------
324------------------------------------------------------------
325-GHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
326----THADAKVQVLDNQNVSNGCVSKILG--------RYYETGSIRPRAI------GGSK
327PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
328------------------------------------------------------------
329------------------------------------------------------------
330TNDNIPS------------------------VSSINRVLRNLA-----------------
331------------------------------------------------------------
332------------------------------------------------------------
333------------------------------------------------------------
334------------------------------------------------------------
335--------------------------------------------------------SEKQ
336Q------MGADGMYDKLRMLNGQTGS-----WGTRPGWYPGTSVPGQPTQ--DGCQQQE-
337-GGGENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
338--------------EALEKE-FERTHYPDVFALERL------AAKIDLPEA---------
339------------------------------------------------------------
340------------------------------------------------------------
341------------------------------------------------------------
342------------------------------------------------------------
343------------------------------------------------------------
344------------------------------------------------------------
345------------------------------------------------------------
346------------------------------------------------------------
347------------------------------------------------------------
348------------------------------------------------------------
349------------------------------------------------------------
350----------------------------------
351>ENSSARP00000010317
352-------------------MQN--------------------------------------
353------------------------------------------------------------
354------------------------------------------------------------
355------------------------------------------------------------
356------------------------------------------------------------
357------------------------------------------------------------
358------------------------------------------------------------
359------------------------------------------------------------
360-SHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
361----THADAKVQVLDNQNVSNGCVSKILG--------RYYETGSIRPRAI------GGSK
362PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
363------------------------------------------------------------
364------------------------------------------------------------
365TNDNIPS------------------------XXXXXXXXXXXX-----------------
366------------------------------------------------------------
367------------------------------------------------------------
368------------------------------------------------------------
369------------------------------------------------------------
370--------------------------------------------------------XXXX
371X------XXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXX--XGCQQQE-
372-GGGENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
373--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
374RRAKWRR-------EEKLRNQRRQASNTPSHIPISS------------------------
375------------------------------------------------------------
376-SFSTSVYQPIPQPTTPV-SSFTSGSVLGRTDTALTNTYSALPPMPSFTMANNLPMQPPV
377---PSQTSS---YSCMLPTSPSVN------GRSYDTYTPPHMQTHMNSQPMGTSGTTSTG
378LISPGVSVPVQVPGSEPDMSQYWPRLQ---------------------------------
379------------------------------------------------------------
380------------------------------------------------------------
381------------------------------------------------------------
382------------------------------------------------------------
383------------------------------------------------------------
384------------------------------------------------------------
385----------------------------------
386>ENSDARP00000067247
387MPQKEYHNQPTWESGVASMMQN--------------------------------------
388------------------------------------------------------------
389------------------------------------------------------------
390------------------------------------------------------------
391------------------------------------------------------------
392------------------------------------------------------------
393------------------------------------------------------------
394------------------------------------------------------------
395-SHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
396------------------VSNGCVSKILG--------RYYETGSIRPRAI------GGSK
397PR-VATPEVVGKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
398------------------------------------------------------------
399------------------------------------------------------------
400TNDNIPS------------------------VSSINRVLRNLA-----------------
401------------------------------------------------------------
402------------------------------------------------------------
403------------------------------------------------------------
404------------------------------------------------------------
405--------------------------------------------------------SEKQ
406Q------MGADGMYDKLRMLNGQSGT-----WGTRPGWYPGTSVPGQPNQ--DGCQQQD-
407-NGGENTNSISSNGEDSDETQMRLQL------KRKLQRNRTSFTQEQI------------
408--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
409RRAKWRR-------EEKLRNQRRQASNSSSHIPISS------------------------
410------------------------------------------------------------
411-SFNTSVYQAIPQPTTPV--SFTTGSMLGRPDTALTNTYTGLPPMPSFTMANNLPMQ---
412---PSQTSS---YSCMLPSSPSVN------GRSFDTYTPPHMQAHMNSQTMATSGTASTG
413LISPGVSVPVQVPGTEPDMSQYWSRLQ---------------------------------
414------------------------------------------------------------
415------------------------------------------------------------
416------------------------------------------------------------
417------------------------------------------------------------
418------------------------------------------------------------
419------------------------------------------------------------
420----------------------------------
421>ENSTNIP00000016123
422P-----------------------------------------------------------
423------------------------------------------------------------
424------------------------------------------------------------
425------------------------------------------------------------
426------------------------------------------------------------
427------------------------------------------------------------
428------------------------------------------------------------
429------------------------------------------------------------
430-GNSGVNQLGGVFINGRPL--------------PPVVRQSIVELAGR-GARPSDISRRLR
431------------------VSHGCVSKILA--------RY---------------------
432------------------------------------------------------------
433------------------------------------------------------------
434------------------------------------------------------------
435------------------------------------------------------------
436------------------------------------------------------------
437------------------------------------------------------------
438------------------------------------------------------------
439------------------------------------------------------------
440------------------------------------------------------------
441------------------------------------------------------------
442------------------------------------------------------------
443------------------------------------------------------------
444------------------------------------------------------------
445------------------------------------------------------------
446------------------------------------------------------------
447------------------------------------------------------------
448------------------------------------------------------------
449------------------------------------------------------------
450------------------------------------------------------------
451------------------------------------------------------------
452------------------------------------------------------------
453------------------------------------------------------------
454------------------------------------------------------------
455----------------------------------
456>ENSOGAP00000008434
457ISVNV-SV----------------------------------------------------
458------------------------------------------------------------
459------------------------------------------------------------
460------------------------------------------------------------
461------------------------------------------------------------
462------------------------------------------------------------
463------------------------------------------------------------
464------------------------------------------------------------
465-GHGGLNQLGGAFVNGRPL--------------PEVVRQRIVDLAHQ-GVRPCDISRQLR
466------------------VSHGCVSKILG--------RYYETGSIRPGVI------GGSK
467PK-VATPKVVEKIGDYKRQNPTMFAWEI----------------------RDRLLAEXXX
468------------------------------------------------------------
469------------------------------------------------------------
470XXXXXXX------------------------XXXXXXXXXXXX-----------------
471----------------------XXXXX---------------------------------
472------------------------------------------------------------
473---------------------------------------------XXXXXXXXXXXXXXX
474--XXXXXXXXXXXPE----------------SPQ-------------SDSLGST--YSIN
475GLLGI----AQPGSDS--------------KRKMDDSD----------------------
476--QDSCR----------------------------LSIDSQSSST---------------
477-------------------------G------PRKHLRTDAF-SQHHL------------
478--------------EPLECP-FERQHYPEAYASPSH------T-KGEQ--XXX-XP-L--
479-LLNS-A-------LDDGKATLTP--SNTPLG----------------------------
480-------------------------------------------------------RNLS-
481-THQTYP--------------VVADPH--SPFAIKQE-TPEVSSSSSTPSSL-SSSAFLD
482---LQQV-GSG------V----------PPFNAFPHAASVYGQFTGQALLSGREMVGPT-
483--LPG--------------------------------------------------YPPHI
484PT----------------------------------------------------------
485--------------------------------------------------------SGQG
486S----YASSA-----I-----------AGMV-----------------------------
487-----------------AXX---------------------------------XXXXXXX
488XXX------XXXXXXX-XXXXXXX------------XXX-------------------XS
489PYYYSST-----------------------------SRPNAP----PTTAT--AFDHL--
490----------------------------------
491>ENSCINP00000013350
492MATYDSCRQASSMALCFNRESLPHK-----------------------------------
493------------------------------------------------------------
494------------------------------------------------------------
495------------------------------------------------------------
496------------------------------------------------------------
497------------------------------------------------------------
498------------------------------------------------------------
499------------------------------------------------------------
500-GHSGMNQLGGMFVNGRPL--------------PDSIRQKIVEFAHN-GARPCDISRILQ
501------------------VSNGCVSKILA--------RYYETGTIRPRAI------GGSK
502PR-VATPEVVNKIASYKRECPSIFAWEI----------------------RDRLLNEGIC
503------------------------------------------------------------
504------------------------------------------------------------
505NNDNIPS------------------------VSSINRVLRNLN-----------------
506------------------------------------------------------------
507------------------------------------------------------------
508------------------------------------------------------------
509------------------------------------------------------------
510------------------------------------------------------------
511----------GDHQTGGFIETTGRDPKSGSQLGLEWSLTCNGWLPQQTMCQEQIAAEGL-
512-MGLKGKESVVESEAKDGSSEARLQL------KRKLQRNRTSFTQIQV------------
513--------------EALEKE-FERTHYPDVFARERL------ATKIDLPEARI-QVWFSN
514RRAKWRR-------EEKIRSQRSSAASDGSDVMRRTNDQQSIG-QCGVYSSVTQQHA---
515-QGSMIY-------GINSFIYSFVSNLTFY-----SEVEHFPPMHRMHEAPYLYGLSSGG
516PSNLTPPPHYTSYDHDRRVEEPSHNTIPTPPSSANQPSPDHDHHGSHMQPLDGGIYQASL
517SGMHVGHQHHALVGAQATDQSAS-SMIVPPMTALQNPANFH-TAEGYWQSGVQG------
518------------------------------------------------------------
519------------------------------------------------------------
520------------------------------------------------------------
521------------------------------------------------------------
522------------------------------------------------------------
523------------------------------------------------------------
524------------------------------------------------------------
525----------------------------------
526>K06B9.5
527MFTKTFSNNYMTSSQSAYCNLQQYHDSRVCLLKCCRVQKVDPYFPRIALNSATSYPTVSG
528TVSLPKAETVEPDLWIKSFKGNEDPLLSDG------------------------------
529------------------------------------------------------------
530------------------------------------------------------------
531------------------------------------------------------------
532------------------------------------------------------------
533------------------------------------------------------------
534------------------------------------------------------------
535-SHTGVNQLGGVFVNGRPL--------------PDTIRAQIVEMSQH-GTRPCDISRQLK
536------------------VSHGCVSKILG--------RYYSTGSVRPGVI------GGSK
537PK-VATPRVVECIAGYKRANPTMFAWEI----------------------RQKLIEDQIC
538------------------------------------------------------------
539------------------------------------------------------------
540GEENVPS------------------------VSSINRIVRNKS-----------------
541------------------------------------------------------------
542------------------------------------------------------------
543------------------------------------------------------------
544------------------------------------------------------------
545------------------------------------------------------------
546------------------------------------------------------------
547---------------FMAQLATPTSV------TPSVARPSSATSQNQR------------
548-----------SPPRGVQQH-MQQSTSVQQLQQFQL------TSAATV------------
549------------------------------------------------------------
550------------------------------------------------------------
551------------------------------------------------------------
552----------------------------------------------------NSLISRPA
553FAIPG-------------------------------------------------------
554------------------------------------------------------------
555------------------------------------------------------------
556-----TTHSINGLLGTFPHSSLLDDKFTNLSTHSADMSLVYPTGLVGEHDWAMRTPMVIL
557PQNYCGQL----------------------------------------------------
558------------------------------------------------------------
559------------------------------------------------------------
560----------------------------------
561>ENSMLUP00000011514
562MDLEKNYPTPRTGRT---------------------------------------------
563------------------------------------------------------------
564------------------------------------------------------------
565------------------------------------------------------------
566------------------------------------------------------------
567------------------------------------------------------------
568------------------------------------------------------------
569------------------------------------------------------------
570-GHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
571------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
572PK-VATPKVVEKIAEYKRQNPTMFAWEI----------------------RDRLLAERVC
573------------------------------------------------------------
574------------------------------------------------------------
575DNDTVPS------------------------VSSINRIIRTKV-----------------
576----------------------QQP-----------------------------------
577------------------------------------------------------------
578---------------------------------------------------PNQPVPASS
579--HSIVSTGSVTQVS----------------SVS-------------TDSAGSS--YSIS
580GILGI----TSPSADTN-------------KRKRDEXX----------------------
581--XXXXX----------------------------XXXXXXXXXX---------------
582-------------------------X------XXXXXXXXXX-XXXXX------------
583--------------XXXXXX-XXXXXXXXXXXXXX-------XXXXXX--XXX-XXXX--
584XXXXX-X-------XXXXXXXXXXX-XXXXXX----------------------------
585-------------------------------------------------------XXXX-
586-XXXXXX--------------XXX------------------------------------
587---------------------------------------------------XRDLASTT-
588--LPG--------------------------------------------------YPPHV
589PP----------------------------------------------------------
590--------------------------------------------------------AGQG
591S----YSAPT-----L-----------TGMVP----------------------------
592------------------GS---------------------------------EFSGSPY
593SHP------QYPSYND-SWRFPNP------------GLL-------------------GS
594PYYYSAA-----------------------------ARGAAP----PAAAT--AYDRH--
595----------------------------------
596>ENSSSCP00000011247
597------------------------------------------------------------
598------------------------------------------------------------
599------------------------------------------------------------
600------------------------------------------------------------
601------------------------------------------------------------
602------------------------------------------------------------
603------------------------------------------------------------
604------------------------------------------------------------
605------------------------------------------------------------
606------------------------------------------------------------
607------------------------------------------------------------
608------------------------------------------------------------
609------------------------------------------------------------
610------------------------------------------------------------
611------------------------------------------------------------
612------------------------------------------------------------
613------------------------------------------------------------
614------------------------------------------------------------
615------------------------------------------------------------
616------------------------------------------------------------
617------------------------------------------------------------
618-------------------V-FERPSYPDVFQASEH---------------------IKS
619EQGNEYSLPALTPGLDEVKSSLSAS-----------------------------------
620------------------------------------------------------------
621------------------------------------------------------------
622--------------------------------TNPELGSNVSGTQTYPVVTGRDMASTTL
623PGYPP-------------------------------------------------------
624------------------------------------------------------------
625------------------------------------------------------------
626------------------------------------------------------------
627----------------HVPPTGQGSYPTSTLAGMVP----------------------GS
628EFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSLPLLPLPMTATSYRGDHIKL
629QADSFGLHIVPV------------------------------------------------
630----------------------------------
631>ENSTGUP00000007459
632MELEKTYATPRASRT---------------------------------------------
633------------------------------------------------------------
634------------------------------------------------------------
635------------------------------------------------------------
636------------------------------------------------------------
637------------------------------------------------------------
638------------------------------------------------------------
639------------------------------------------------------------
640-GHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
641------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
642PK-VATPKVVEKIAEYKRQNPTMFAWEI----------------------RDRLLAERVC
643------------------------------------------------------------
644------------------------------------------------------------
645DNDTVPS------------------------VSSINRIIRTKV-----------------
646----------------------QQP-----------------------------------
647------------------------------------------------------------
648---------------------------------------------------PNQQVPASS
649--HSIASTGSVTQVS----------------SVT-------------TDSAGSS--YSIS
650GILGI----ASPGTESN-------------KRKRDEGI----------------------
651--QESPV----------------------------PNGHSLPSRD---------------
652-------------------------F------LRKQMRGDLF-TQQQL------------
653--------------EVLDRV-FERQHYSDIFTTTE-------PIKPEQ--ATE-YSAM--
654ASLAG-G-------LDDMKANITSP-TSADLG----------------------------
655-------------------------------------------------------ASVP-
656-GPQSYP--------------IVT------------------------------------
657---------------------------------------------------GRELASTT-
658--LPG--------------------------------------------------YPPHV
659PP----------------------------------------------------------
660--------------------------------------------------------AGQG
661S----YSTPA-----L-----------TGMVP----------------------------
662------------------GD---------------------------------EFSGSPY
663SHP------QYSTYND-SWRFPNP------------GLL-------------------GS
664PYYYSAT-----------------------------ARGAAA----PAAAA--AYDRH--
665----------------------------------
666>ENSSSCP00000011246
667----------------------MDMHCKADP---FSAM----HP----------------
668------------------------------------------------------------
669------------------------------------------------------------
670------------------------------------------------------------
671------------------------------------------------------------
672------------------------------------------------------------
673------------------------------------------------------------
674------------------------------------------------------------
675-GHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
676------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
677PK-VATPKVVDKIAEYKRQNPTMFAWEI----------------------RDRLLAEGIC
678------------------------------------------------------------
679------------------------------------------------------------
680DNDTVPS------------------------VSSINRIIRTKV-----------------
681----------------------QQPFH---------------------------------
682------------------------------------------------------------
683---------------------------------------------PTPDG-AGTGVTAPG
684--HTIVPSTASPPVS----------------SAS-------------NDPVGS---YSIN
685GILGI------PRSNGE-------------KRKRDEVEVYTDPAHIRGGGGLHLVWTLRG
686MGARGTM----------------------------VRGQGK-------------------
687------------------------------------------------------------
688------------------------------------------------------------
689------------------------------------------------------------
690------------------------------------------------------------
691------------------------------------------------------------
692------------------------------------------------------------
693------------------------------------------------------------
694------------------------------------------------------------
695------------------------------------------------------------
696------------------------------------------------------------
697------------------------------------------------------------
698------------------------------------------------------------
699------------------------------------------------------------
700----------------------------------
701>ENSTBEP00000014786
702----------------------KNMHCKEEP---FSAK----PT----------------
703------------------------------------------------------------
704------------------------------------------------------------
705------------------------------------------------------------
706------------------------------------------------------------
707------------------------------------------------------------
708------------------------------------------------------------
709------------------------------------------------------------
710-GHGGVNQLGGV-VNGRPL--------------PDVV-QRIVELTHQ-GVRPCDISRQLR
711------------------VSHGCVSKI-G--------RYYETGSIKPGVI------GGSK
712PK-VATPKVVDKIAEYKRQNPTMFAWET----------------------HGRLLAEGIC
713------------------------------------------------------------
714------------------------------------------------------------
715DNDTVPS------------------------VSTINXXXXXXX-----------------
716----------------------XXXXX---------------------------------
717------------------------------------------------------------
718---------------------------------------------XXXXX-XXXXXXXXX
719--XXXXPSTASPPVS----------------SAS-------------NDPVGS---YSIN
720GILGI------PRSNGE-------------KRKRDEVEVYTDPAHIRGGGGLHLVWTLR-
721------------------------------------------------------------
722------------------------------------------------------------
723------------------------------------------------------------
724------------------------------------------------------------
725------------------------------------------------------------
726------------------------------------------------------------
727------------------------------------------------------------
728------------------------------------------------------------
729------------------------------------------------------------
730------------------------------------------------------------
731------------------------------------------------------------
732------------------------------------------------------------
733------------------------------------------------------------
734------------------------------------------------------------
735----------------------------------
736>ENSACAP00000002317
737--------------------PA--------------------------------------
738------------------------------------------------------------
739------------------------------------------------------------
740------------------------------------------------------------
741------------------------------------------------------------
742------------------------------------------------------------
743------------------------------------------------------------
744------------------------------------------------------------
745-GHSGVNQLGGVFVNGRPL--------------PDSTRQKIVELAHS-GARPCDISRILQ
746----THADAKVQVLDNQNVSNGCVSKILG--------RYYETGSIRPRAI------GGSK
747PR-VATPEVVSKIAQYKRECPSIFAWEI----------------------RDRLLSEGVC
748------------------------------------------------------------
749------------------------------------------------------------
750TNDNIPS------------------------VSSINRVLRNLA-----------------
751------------------------------------------------------------
752------------------------------------------------------------
753------------------------------------------------------------
754------------------------------------------------------------
755--------------------------------------------------------SEKQ
756Q------MGADGMYDKLRMLNGQSGT-----WGTRPGWYPGTSVPGQPAP--DGCPQQE-
757-GGAENTNSISSNGEDSDEAQMRLQL------KRKLQRNRTSFTQEQI------------
758--------------EALEKE-FERTHYPDVFARERL------AAKIDLPEARI-QVWFSN
759RRAKWRR-------EEKLRNQRRQASNTPSHIPISS------------------------
760------------------------------------------------------------
761-SFSTSVYQPIPQPTTPV-SSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPV
762---PSQTSS---YSCMLPTSPSVN------GRSYDTYTPPHMQTHMNSQPMGTSGTTSTG
763LISPGVSVPVQVPGSEPDMSQYWPRLQ---------------------------------
764------------------------------------------------------------
765------------------------------------------------------------
766------------------------------------------------------------
767------------------------------------------------------------
768------------------------------------------------------------
769------------------------------------------------------------
770----------------------------------
771>ENSGACP00000003177
772----------------------MDIHCKADP---FTAM----H-----------------
773------------------------------------------------------------
774------------------------------------------------------------
775------------------------------------------------------------
776------------------------------------------------------------
777------------------------------------------------------------
778------------------------------------------------------------
779------------------------------------------------------------
780-RHGGVNQLGGVFVNGRPL--------------PDVVRQRIVELAHQ-GVRPCDISRQLR
781------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
782PK-VATPKVVDKIADYKRQNPTMFAWEI----------------------RDRLLAEGVC
783------------------------------------------------------------
784------------------------------------------------------------
785DNDTVPS------------------------VSSINRIIRTKV-----------------
786----------------------QQPFH---------------------------------
787------------------------------------------------------------
788---------------------------------------------PSPDG---SSLSTPG
789--HTIVPSTTSPPVT----------------SAS-------------NDPAGS---YSIN
790GILGI------PRSNGE-------------KRKRDE------------------------
791------------------------------------------------------------
792------------------------------------------------------------
793------------------------------------------------------------
794------------------------------------------------------------
795------------------------------------------------------------
796------------------------------------------------------------
797---------------------------------------------------GRDMANTT-
798--LPG--------------------------------------------------YPPHV
799PP----------------------------------------------------------
800--------------------------------------------------------TGQG
801S----YPTST-----L-----------AGMVP----------------------------
802------------------GS---------------------------------EFSGNPY
803SHP------QYTTYND-AWRFSNP------------ALL-------------------SS
804PYYYSAA-----------------------------SRGSAP----HTAAT--AYDRH--
805----------------------------------
806>ENSGACP00000022114
807IPPPPP------------------------------------------------------
808------------------------------------------------------------
809------------------------------------------------------------
810------------------------------------------------------------
811------------------------------------------------------------
812------------------------------------------------------------
813------------------------------------------------------------
814------------------------------------------------------------
815-GHGGLNQLGGMFVNGRPL--------------PEVIRQRIVDMAHQ-GVRPCDISRQLR
816------------------VSHGCVSKILG--------RYYETGSIKPGVI------GGSK
817PK-VATPKVVDKIAEYKRQNPTMFAWEI----------------------RDRLLAEEVC
818------------------------------------------------------------
819------------------------------------------------------------
820DSDTVPS------------------------VSSINRIIRTKV-----------------
821----------------------QQPFN---------------------------------
822------------------------------------------------------------
823---------------------------------------------LPLDG----KGLSPG
824--HTLIPSSAVTPPE----------------SPH-------------SDSLGST--YSIS
825GLLGI----PQPSAEG--------------KRSHDDSD----------------------
826--QESCR----------------------------HSVDSQGSGG---------------
827-------------------------V------PRKQMRMDHF-SA-AT------------
828--------------PHLDCG-FDRHQYPPDSFGSAS------SSKTEQ---TL-YP-L--
829SLING-S-------LDEAKASLST--CGSAIG----------------------------
830-------------------------------------------------------RNLT-
831-AHQSYA--------------MVTESRQPLPLCLKQEMSPEVTSTSPSPNMALSNLAFME
832LQALQKPLSAGGGGGSSC---SNSNHYPNAFNSFSHHAPVYGQFSSQSIISGRDMVSST-
833--LPG--------------------------------------------------YPPHI
834PS----------------------------------------------------------
835--------------------------------------------------------PAQS
836G----YSSSA-----I-----------TGMVA----------------------------
837-----------------AGT---------------------------------DYSGQTY
838SHS------PYT-YSE-AWRFTNS------------SIL-------------------GS
839PYYYSTA-----------------------------SRTAPP----P--AA--AYDHL--
840----------------------------------
841>ENSOCUP00000019685
842-------------------PSS--------------------------------------
843------------------------------------------------------------
844------------------------------------------------------------
845------------------------------------------------------------
846------------------------------------------------------------
847---------------------------------------------------------…

Large files files are truncated, but you can click here to view the full file